KEGG   Xenopus tropicalis (western clawed frog): 448358Help
Entry
448358            CDS       T01011                                 

Gene name
arg1
Definition
(RefSeq) arginase 1
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00220  Arginine biosynthesis
xtr00330  Arginine and proline metabolism
xtr01100  Metabolic pathways
xtr01230  Biosynthesis of amino acids
Module
xtr_M00029  Urea cycle
xtr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    448358 (arg1)
   00330 Arginine and proline metabolism
    448358 (arg1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     448358 (arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 448358
NCBI-ProteinID: NP_001006714
Xenbase: XB-GENE-966913
UniProt: Q6DIU5
Position
5
AA seq 323 aa AA seqDB search
MSSQAKTSVGVIGAPFSKGQPRRGVEEGPKYLRDAGVIEKLRELGNDVRDYGDLDFPDVP
NDITFNNVKNPRTVGKATEKLANAVTAVKKADRTCLVIGGDHSLAVGTIAGHAAVHRDLC
VVWVDAHADINTPSTSPSGNLHGQPLSFLMKELKSKMPDVPGFEWVKPCLSAKDIVYIGL
RDVDPGEHYILKTLGIKYYSMSEVDYLKIDKVMEETIEYLVGKQKRPIHLSFDIDGLDPS
IAPATGTAVPGGLTYREGMYITEKLCRTGLLSAVDIMEVNPSRGETKRDVELTVNTALDM
TLSCFGKAREGYHTSTMTLPDII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccaagcaaagacctcagtgggagtcattggagcccccttctcaaagggacag
ccaagaagaggagtggaagaagggccgaaatatttaagagatgctggggtaattgagaaa
ttaagagaacttggcaatgacgttcgagattatggtgatctggattttcccgatgtgcct
aacgacataacatttaacaatgtgaaaaacccacgcacagttgggaaagccacagagaaa
ttggccaatgctgttacggcggtaaaaaaagctgacaggacatgcttagtcattggggga
gatcacagcttggcagtgggaacaatcgctggtcatgcagcagttcaccgtgatctttgt
gttgtttgggtggatgcccatgcagatattaacactccatccacatcacccagtggcaac
cttcatggacagccattatcctttttaatgaaagaactcaaaagcaagatgcctgatgtt
ccaggatttgagtgggtgaaaccatgcctcagtgccaaagacattgtatacattggttta
agagatgtagacccaggagagcattacattctgaagacacttggcataaaatactattca
atgtctgaagtggattatcttaaaatagacaaagtaatggaagagacaattgaatatttg
gttggaaagcagaagagacccattcatttaagtttcgacattgatggtctggacccaagt
attgccccagctactggaactgctgtccctggagggctgacttacagggaaggcatgtac
atcacagaaaaactctgtaggacaggattgctttcggcagtggatataatggaagtaaac
ccatcacgcggagaaacaaagcgagatgttgagctcacagttaacactgcgcttgacatg
actttgtcatgcttcggaaaagctcgtgaaggatatcatacatcaacaatgacacttcca
gatattatataa

DBGET integrated database retrieval system