KEGG   Xenopus tropicalis (western clawed frog): 448361
Entry
448361            CDS       T01011                                 

Symbol
krt78.7
Name
(RefSeq) keratin 78, gene 7
  KO
K07605  type II keratin, basic
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    448361 (krt78.7)
   04147 Exosome [BR:xtr04147]
    448361 (krt78.7)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     448361 (krt78.7)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   448361 (krt78.7)
  Exosomal proteins of other body fluids (saliva and urine)
   448361 (krt78.7)
  Exosomal proteins of colorectal cancer cells
   448361 (krt78.7)
  Exosomal proteins of bladder cancer cells
   448361 (krt78.7)
SSDB
Motif
Pfam: Filament Keratin_2_head AAA_13 ATG14 TPR_MLP1_2 DUF1192 DUF4407 ADIP Bap31_Bap29_C DHR10 DUF1664 DUF948 Fib_alpha DUF4686
Other DBs
NCBI-GeneID: 448361
NCBI-ProteinID: NP_001006716
Xenbase: XB-GENE-876590
UniProt: F7ENH4 A0A803KKU3
Position
2
AA seq 631 aa
MSFSQVSIKKRQTVSSGGGGGGRGGFSACSLGAIGGGSRAGGSYGSRSVYNLGGKSRTSI
SAASARSMVGGLGSAAGGGFGGGAGGGFGGGAGGGFGGGAGGGFGGGFGGGHGGGMFGGA
GGMGGMGGMGGMGGMGGMGGMGGMGGPGFDGGDMGFPVCPPGGIQQVTINTQLLQPLNLT
IDPNVQKVKTEEREQIKTLNNKFAAYIDKVRFLEQQNKVLETKWKLLQEQGTKGSTKRAS
LEPLFEKYIGDLRRYLDTLTNEKARLLQELKNLQDLVEEYKKKYEDEINKRTKAENDFVV
LKKDVDAAYMIKTELEAKVDAVTSEINFLRTLFAAELSQVHDSVTDTSVVLTMDNNRDFN
LEGIIQDVKAQLELAAQRSKMEAEALYDNKYKELQRTAEGHGDSIKNSKTEIAELNRRIQ
RLRAEIENIKKQIAGLNQSIAGAEEKGNLALKDAEKKLQDLEAAEKKLKEDMARQLKEYQ
ELLAAKISLDVEISTYGLMLGGEEGRMSGEIANNVSISVISGGSSVYSALGGAAGGMGGG
MGGGMGGGMGMGGGMGMGVGMGGGMGGGMGGGMGGGMGMGGGMGSACGYGQGMGGMGFEG
GSMHGGSSYGHSGGKTSVAIASTTSTTKKTY
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgtctttctcacaagtctccatcaagaagcgacaaactgttagcagtggtggtggtggt
ggtggaagagggggttttagcgcgtgctcacttggagcaattggaggaggatctcgggct
ggaggtagctatgggtcacgcagtgtctataaccttggtggaaaatctagaacttccata
agtgcagccagtgctcgaagtatggtaggaggacttggtagtgctgctggaggaggattt
ggtggtggtgctggtggaggatttggtggtggtgctggtggaggatttggtggtggtgct
ggtggaggatttggtggtggctttggaggaggacatggtggtggaatgtttggtggtgca
gggggcatgggtggcatgggaggcatgggtggcatgggaggtatgggaggcatgggtgga
atgggtggcatgggaggcccaggatttgatggaggggatatgggattccctgtttgccca
cctggtggaattcagcaggttactatcaatacacaacttctgcagccacttaatctgact
atagatccaaacgtccagaaagtaaaaacagaggaaagagaacaaattaaaactctcaac
aacaagtttgcagcttacattgacaaggtcagatttctggaacagcaaaacaaagtccta
gaaacaaaatggaaactgctgcaggaacagggaactaagggcagcaccaaaagggccagc
ctagagcccctgtttgagaagtacattggcgacctgaggagatatttagatactttaaca
aatgaaaaggcccgtttgctgcaagaactgaagaatctgcaagatcttgtggaggaatat
aagaaaaaatacgaggatgaaattaacaagcgtacaaaagcagaaaacgattttgtggta
cttaagaaggatgttgatgctgcctacatgattaaaacagaacttgaggccaaggtggat
gcagtgacaagtgaaatcaacttcttaagaactctttttgctgcggaattgtcacaggta
catgatagcgtcaccgacacctctgttgttctgactatggataacaaccgtgactttaac
ctggaaggtatcattcaggatgttaaagcacaattagaactagctgcacaaagaagcaaa
atggaagctgaagcattgtacgataataagtacaaggagctgcagagaacagctgaagga
catggggacagcataaagaattccaagactgaaatagcagaactgaaccgtaggattcag
aggctgagggctgaaattgaaaatatcaagaagcagattgcaggtctgaatcaatccatt
gctggagctgaagaaaagggcaaccttgctctcaaggatgcagaaaagaaacttcaggat
cttgaagctgctgaaaagaaacttaaggaggacatggctcgtcagcttaaagagtaccaa
gaacttctggctgctaagatttcactggatgttgaaattagcacttacggactcatgctg
ggaggagaagagggcagaatgtctggagagattgccaacaatgtcagcatatctgtaatc
agcggaggttccagtgtatacagtgctcttggcggtgcagctggcggaatgggaggcggc
atgggaggcggcatgggcggcggaatgggcatgggcggcggaatgggcatgggtgtcgga
atgggaggcggcatgggtggcggaatgggaggcggcatgggtggcggaatgggaatggga
ggcggcatgggatctgcatgtggatatggccaaggcatgggaggaatgggatttgaaggt
ggctccatgcatggaggaagctcttatggccattctggaggcaaaacctcagtggcaatt
gcatcaacaacatccacaaccaagaaaacctattaa

DBGET integrated database retrieval system