KEGG   Xenopus tropicalis (western clawed frog): 448407
Entry
448407            CDS       T01011                                 

Gene name
thap1
Definition
(RefSeq) THAP domain-containing protein 1
  KO
K23203  THAP domain-containing protein 1/3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    448407 (thap1)
   03036 Chromosome and associated proteins [BR:xtr03036]
    448407 (thap1)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    448407 (thap1)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Gene silencing
   Transposable elements
    448407 (thap1)
SSDB
Motif
Pfam: THAP Tropomyosin_1 Macoilin MPS2 TMF_DNA_bd ADIP BDV_G GrpE Atg14 FliJ
Other DBs
NCBI-GeneID: 448407
NCBI-ProteinID: NP_001006738
Xenbase: XB-GENE-1008758
UniProt: Q6DIN8
Position
1
AA seq 225 aa
MVQSCSAYGCKNRYDKDKPISFHKFPLKRPLLCRKWEAAVRRADFKPTKYSSICSDHFTA
DCFKRECNNKLLKDNAVPTIFAHTEIKKKSGKAVKKEQLPAEPEPVPSVPEVDPAIGLLL
PPLYTPSHIAVICDHNYTVEDTVHQRRRIQQLEEQVDKLRKKLKIANQKCRRQERSLEKL
EREVSEYREAKGSGYVIFPGNYYEVLNENEYKELAPEITYKEIIL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtgcaatcgtgctcggcttacggttgcaagaatcgctacgataaggataaacccatc
tcttttcacaagtttccccttaaacgcccgctactctgcaggaaatgggaagcagctgta
cgtagagctgactttaaacctacaaagtacagtagcatttgctctgaccattttacagct
gattgcttcaaaagagaatgcaacaataagcttcttaaggataatgctgtgccaacaata
tttgcacatacagaaataaagaaaaagagtggaaaagctgttaaaaaggagcagctgcca
gctgaacctgaaccagtcccgtctgttcctgaagtagaccctgctattggattgctactc
cctcctctgtatacaccaagtcacattgcagtgatttgtgaccacaattatacagtggaa
gatactgttcatcagaggagaaggatacaacagcttgaagagcaagttgataaacttagg
aaaaagctgaagatagctaaccagaagtgtcgaaggcaggaacgtagtttggaaaaactg
gagagagaggtttctgaatatagggaagccaagggatctggctacgttatcttccctggc
aattattatgaagtcttaaatgaaaatgaatacaaagaactggctccagaaataacatat
aaagaaatcattctgtaa

DBGET integrated database retrieval system