KEGG   Xenopus tropicalis (western clawed frog): 448613
Entry
448613            CDS       T01011                                 

Gene name
pola2
Definition
(RefSeq) DNA polymerase alpha subunit B
  KO
K02321  DNA polymerase alpha subunit B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03030  DNA replication
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    448613 (pola2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xtr03032]
    448613 (pola2)
DNA replication proteins [BR:xtr03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    448613 (pola2)
SSDB
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N
Other DBs
NCBI-GeneID: 448613
NCBI-ProteinID: NP_001005060
Xenbase: XB-GENE-5916783
UniProt: Q6DEY9
Position
4
AA seq 597 aa
MPVSAKSIEEELTVFDVNFEDDEVPEKMVELCTVHRLQEEDMVNEWMAFSTTRNLPLTVS
NLNILEHEVLNKKSARPRPSQKKEKHCGNRDFNTIQELIEVETEEENLLDSYATPAKGSQ
KRNLSTPEHPQSKRISVNRSPHVLFSPASFSPSATPSQKYGSRTNRGEVVTTYGELQGTT
WNGGSGRNTSVELFTCQDEPLTKMYKFMFQKLMDIREVVSSKIEELGASLKNHFQIDEFT
SVSFPAQETVTVLGQIGCDSNGKLNSKSVILEGDREHSAGMQVPVDLSELKEYSLFPGQV
VIMEGTNSTGRRFVPTKLYEGVPLPFHQPSKEFEECPQQMVITACGPFTTSDTITYDALK
DLIDVLNRDCPDICILLGPFLDAKHEQIENLQLTVTFEDVFKRCLKMIIEGTRLSGCHLV
FVPSLRDVHHDPVYPQPPFSCFEPAKEDKDRVHFVADPCTLSVNGVILGITSTDLLFHMG
AEEISSSVGAPDRFSRILRHILTQRSYYPLYPPNEEINVDYEAFYSYAPMPVTPDIFIVP
SELRYFIKDVTGCICINPGRLTKGLVGGTYARFLVKSGAMGSEGKRSPCISAQVVRI
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgcctgtgtcagcaaagagcattgaagaggagctaacggtctttgacgtcaactttgag
gatgatgaagttccagagaaaatggtggagctctgtacagttcaccgtcttcaggaagag
gacatggtcaatgaatggatggctttcagtaccactcggaaccttccgctcacagtcagc
aaccttaatatactggaacatgaggttttgaacaagaaaagtgccagaccacgcccatcc
cagaagaaagagaaacattgtggaaacagggattttaatacaattcaagaacttattgaa
gtggaaacagaagaagaaaatctcctggattcatatgctacacctgctaaaggatcccaa
aagcgtaacttgtctactccagaacatcctcagtctaaacgcatatctgtaaaccgaagc
ccccatgtcctcttctccccagcaagcttttcccccagtgccaccccgtctcaaaagtat
ggctctcgaaccaaccgaggagaagtggtgacaacctatggagagttacaaggaactaca
tggaatggtggcagtggaagaaatactagtgttgaactgttcacctgtcaggatgaacca
ctgacaaaaatgtataagttcatgtttcagaagttaatggacatcagagaagtggttagc
agtaagatagaagaacttggtgcatctctgaagaaccatttccaaattgatgagtttacc
tctgtttctttcccagctcaagagactgtgaccgtgctaggacagattggatgtgacagc
aacggcaagttaaattccaaatctgtcatccttgagggggacagagagcactcagcaggg
atgcaggttccagttgacttgtctgaattaaaagagtattctctgtttccaggacaggta
gtaatcatggagggcaccaacagcaccggcaggaggtttgtccctactaaactttatgag
ggggttccacttccttttcaccagcccagcaaagaatttgaagaatgtccacagcagatg
gtaatcacagcgtgcggaccctttaccacatcagatactatcacctatgatgccctgaag
gatcttattgacgttcttaacagagactgtccagatatctgcatcctgcttggtcccttt
ttggatgcaaagcatgagcaaatagagaacctgcaactcacagtgacatttgaagatgtg
tttaagcgttgtctgaaaatgattatcgaaggcacacgtctttcggggtgccatctggtc
ttcgttccatctctcagagatgttcatcatgatcctgtctatcctcagccaccattcagc
tgttttgaaccggccaaagaagacaaggacagggtccattttgttgccgatccctgcacg
ttgtctgtcaatggtgttatcttaggcataacctctacagacttgctctttcatatgggt
gcagaggaaataagcagctctgtgggggctccggatcgatttagtcggattcttagacac
attctgacccaaagaagttactatccactgtatccacccaatgaagaaataaatgttgac
tatgaggctttctacagctacgcccctatgcctgtcactccagacatttttatagtcccg
tctgagcttcgctattttatcaaggatgtcacaggctgcatctgcattaaccctgggcgg
ctgacaaagggactggtgggcggcacatatgcacgctttctggtcaaaagtggagccatg
gggtctgaaggaaagagatctccttgtatttctgctcaggtggtgaggatctaa

DBGET integrated database retrieval system