KEGG   Xenopus tropicalis (western clawed frog): 448667
Entry
448667            CDS       T01011                                 

Gene name
tra2b
Definition
(RefSeq) transformer-2 protein homolog beta
  KO
K12897  transformer-2 protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    448667 (tra2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    448667 (tra2b)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    448667 (tra2b)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     448667 (tra2b)
Spliceosome [BR:xtr03041]
 Common components
  Common spliceosomal components
   SR proteins
    448667 (tra2b)
SSDB
Motif
Pfam: RRM_1 Apt1 RRM_3 RRM_occluded
Other DBs
NCBI-GeneID: 448667
NCBI-ProteinID: NP_001006878
Xenbase: XB-GENE-5864557
UniProt: Q6DES6
Position
9
AA seq 293 aa
MSDSGEQNYADRESRSASRSGSARQSGKSASQSPNHSAARSRSKEGSRHSRSKTRSRSDS
RSRSRRSSRRHYTRSRTRSRSRRRSRSRSHSRDYRRRRSHSHSPMSTRRRHVGNRANPDP
NCCLGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAK
ERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGGYDDREY
YSRSYRGGGGGGGGWRGGQDRDQFSRRRSPSPYYSRGSYRSRSRSRSYSPRRY
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagtgatagcggggagcaaaattatgccgatcgggaatcaagatctgcatcaaggagt
ggaagtgcacgacaatctggcaagtctgcaagtcagtccccgaatcactctgctgcccgg
tctcgttcaaaagaaggatccaggcattccagatcaaaaaccagatccagatctgactca
aggtctagatcaagaagaagttctcgtagacattatacaagatcacgcactcgctctagg
tctcggaggagatcaagaagccggtcacacagtagagactatagaagacgtcgcagccat
agtcattctcctatgtctactcggcgaaggcatgttggaaacagggctaatccagatcct
aactgctgtctgggagtatttggtttgagtctatatactacagaacgtgatcttagagaa
gtattttcgaagtatggtccaattagcgatgtttccatagtttatgaccagcagtcaaga
cgttcaagaggattctcttttgtatattttgaaaatgttgacgatgcaaaagaggcaaaa
gaacgtgctaatggcatggaacttgatggacgacggatacgtgttgatttctcaataaca
aaacgacctcatacacctacaccaggaatatacatgggaagaccaacatatggcagttca
cggcgcagagattattatgatcggggatatgacagaggcgggtatgacgaccgagagtac
tacagcagatcctacagagggggaggaggtggaggtggaggatggcgtggaggacaagac
agagaccagttttctaggaggcggtctccttcaccatactatagccgtggtagctacaga
tctcgctccagatcacgatcatactctccacgtcgctattga

DBGET integrated database retrieval system