KEGG   Xenopus tropicalis (western clawed frog): 448691Help
Entry
448691            CDS       T01011                                 

Gene name
sumo1, dap-1, dap1, gmp1, ofc10, pic1, senp2, smt3, smt3c, smt3h3, sumo-1, sumo1-a, sumo1-b, ubl1, xsumo-1, xsumo1
Definition
(RefSeq) small ubiquitin-like modifier 1
  KO
K12160  small ubiquitin-related modifier
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    448691 (sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xtr03019]
    448691 (sumo1)
   04121 Ubiquitin system [BR:xtr04121]
    448691 (sumo1)
   03029 Mitochondrial biogenesis [BR:xtr03029]
    448691 (sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xtr04812]
    448691 (sumo1)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     448691 (sumo1)
Ubiquitin system [BR:xtr04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   448691 (sumo1)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    448691 (sumo1)
Cytoskeleton proteins [BR:xtr04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    448691 (sumo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 448691
NCBI-ProteinID: NP_001005111
Xenbase: XB-GENE-978491
UniProt: Q6DEP7
Position
9
AA seq 102 aa AA seqDB search
MSDQEAKPSSEDLGDKKEGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPM
NSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGGHSTI
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcaggaagctaaaccatctagcgaggatctaggagacaaaaaagaaggaggg
gattatatcaaactcaaagtcatcggacaggatagcagtgaaattcactttaaggtaaag
atgacaacgcatctcaaaaagctgaaagagtcatactgtcagagacagggtgttccaatg
aattctctcaggtttttgtttgaagggcaaagaatctcagatcaccagactcctaaggag
ctcggtatggaggaagaggatgttattgaagtttatcaggaacagactgggggccactcg
acaatttaa

DBGET integrated database retrieval system