KEGG   Xenopus tropicalis (western clawed frog): 448705Help
Entry
448705            CDS       T01011                                 

Gene name
uba52, cep52, hubcep52, rpl40
Definition
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  large subunit ribosomal protein L40e
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    448705 (uba52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xtr03011]
    448705 (uba52)
Ribosome [BR:xtr03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    448705 (uba52)
  Archaea
    448705 (uba52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 448705
NCBI-ProteinID: NP_001005123
Xenbase: XB-GENE-939925
UniProt: Q6AZL4 F6TL14
Position
1
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatctttgttaaaacccttactgggaaaacaatcacccttgaggttgagcccagt
gatactattgaaaatgtgaaggccaaaatccaggacaaggaaggtattccccctgaccaa
cagcgtctgatctttgctggtaaacaacttgaagatggacgcaccctatctgattataac
atccagaaagagtccactttgcatctggtgttgcgtctgcgtggtggtatcattgagcct
tcccttcgccaacttgctcagaagtacaactgtgacaaaatgatttgccgcaagtgctat
gcccgccttcaccctcgtgctgtaaattgccgtaagaagaagtgtggtcacaccaataac
ctgcgtcccaagaagaaggtcaaataa

DBGET integrated database retrieval system