KEGG   Xenopus tropicalis (western clawed frog): 493250
Entry
493250            CDS       T01011                                 

Symbol
foxc1
Name
(RefSeq) forkhead box protein C1
  KO
K09396  forkhead box protein C
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    493250 (foxc1)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    493250 (foxc1)
SSDB
Motif
Pfam: Forkhead Lin-8
Other DBs
NCBI-GeneID: 493250
NCBI-ProteinID: NP_001007864
Xenbase: XB-GENE-479055
UniProt: Q68F77
Position
6
AA seq 495 aa
MQARYSVSSPNSLGVVPYLSGEQSYYRAAAAAAAAGGGYTGMAAPMSMYSHPAHEQYQAG
MARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNK
QGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDV
VKDATKEDKDRLLKEHHGSQPAAAQQQRQQQQGQAQAEQDSGSQPVRIQDIKTENGTSSP
PQAMSPALSTVPKIESPDSSSSMSSGSPHSIPSNRSMSLEAAESHHPHQQHHHSQGFSVD
NIMTSLRGSPQGSGELPSPLISSSRTGIAPSSLLTYSPGQGSIYSPPCSQGTSSGGGAGT
YHCNMQAMSLYSGDRSGHLTPANTPAATTVEDTLPDYSITTTTTSALSHGNQEHPHQGRL
PSWYLNQAGDLGHLAGATYPGQQQNFHSVREMFESQRLGLNSSPVNGNSSCQMSFPPSQS
LYRTSGAFVYDCSKF
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgcaggcgcgctactcggtgtccagccccaactccctgggagtcgtgccctacctcagc
ggggagcagagttactacagggcggctgcagctgcggcggcggcaggaggaggctacacg
ggcatggctgcccccatgagcatgtactcccaccccgcgcatgaacagtaccaggccggc
atggccagagcctatgggccttacaccccccaaccccagcccaaggacatggtgaaaccc
ccctacagctacatcgccctcatcaccatggccatccagaacgcccctgaaaagaagatc
accctgaatggcatctaccagttcataatggagaggttccccttctatcgagacaacaag
cagggctggcagaatagtattaggcacaacttatccctcaacgagtgttttgtcaaggtg
ccaagggacgacaagaagccgggtaagggcagctactggaccttggacccggactcgtac
aacatgtttgaaaatggcagctttctgaggaggaggcgcaggttcaagaaaaaagatgtg
gtcaaagatgccactaaggaggacaaagatcggctcctgaaagagcatcatggcagccag
cccgcagccgcgcaacagcagcgccagcagcagcagggccaggcccaagcggagcaggac
agcggctcccagccggtcaggatccaggatataaagaccgagaacggcacctcgtctcct
ccccaggccatgtctcctgcactcagcacggtgcccaagatagagagtccggatagcagc
agcagcatgtccagtggcagcccccacagcatcccgtccaacaggtccatgagcctggag
gctgcagagtctcaccacccgcaccagcagcaccaccacagccagggcttcagtgtggat
aacatcatgacctccctcagggggtccccgcagggctcaggagaactgccttctcccctc
atctcctcttccaggacaggtatcgccccctcctccctactcacctactccccaggccag
ggctccatctacagccccccctgcagtcagggcacaagcagcggcggtggggcagggacc
tatcactgcaacatgcaggccatgagcttgtactctggggacaggtcgggccacttgact
cctgccaacacccctgcagctaccacggtggaagacaccttacctgactattccatcact
accaccaccacctctgccctgagccacggcaaccaggagcaccctcaccagggccgattg
ccctcttggtatctcaatcaagctggggatttgggccacttggccggggccacctacccg
gggcagcagcagaacttccactcggtgcgagagatgttcgagtcgcagagattaggattg
aacagttcccctgtgaatggaaatagcagctgtcagatgtctttcccccccagccagtcc
ttgtaccgcacctcgggggcgtttgtctatgactgcagcaaattctga

DBGET integrated database retrieval system