KEGG   Xenopus tropicalis (western clawed frog): 493420Help
Entry
493420            CDS       T01011                                 

Gene name
map2k1, map2k2, mapkk1, mek1, mkk1, prkmk1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04114  Oocyte meiosis
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04270  Vascular smooth muscle contraction
xtr04370  VEGF signaling pathway
xtr04371  Apelin signaling pathway
xtr04510  Focal adhesion
xtr04540  Gap junction
xtr04620  Toll-like receptor signaling pathway
xtr04810  Regulation of actin cytoskeleton
xtr04910  Insulin signaling pathway
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04916  Melanogenesis
Module
xtr_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    493420 (map2k1)
   04012 ErbB signaling pathway
    493420 (map2k1)
   04370 VEGF signaling pathway
    493420 (map2k1)
   04371 Apelin signaling pathway
    493420 (map2k1)
   04068 FoxO signaling pathway
    493420 (map2k1)
   04150 mTOR signaling pathway
    493420 (map2k1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    493420 (map2k1)
  Cell growth and death
   04114 Oocyte meiosis
    493420 (map2k1)
   04210 Apoptosis
    493420 (map2k1)
   04218 Cellular senescence
    493420 (map2k1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    493420 (map2k1)
   04540 Gap junction
    493420 (map2k1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    493420 (map2k1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    493420 (map2k1)
  Endocrine system
   04910 Insulin signaling pathway
    493420 (map2k1)
   04912 GnRH signaling pathway
    493420 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    493420 (map2k1)
   04916 Melanogenesis
    493420 (map2k1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    493420 (map2k1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     493420 (map2k1)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: STE group
  STE7 family
   493420 (map2k1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like DUF3216
Motif
Other DBs
NCBI-GeneID: 493420
NCBI-ProteinID: NP_001008058
Xenbase: XB-GENE-478822
UniProt: Q66JE6
Position
3
AA seq 395 aa AA seqDB search
MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVEGDPASSELAPRPRPPGRPIS
SYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVH
SFIKQSELEEVDFAGWLCSTMGLKQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaagaagcctacgcccatacagctgaaccccaaccctgaggggactgctgtg
aacggaacccctacagccgagacaaaccttgaagctctgcagaaaaagttggaagagctg
gagctggatgagcagcagaggaagcgtctagaggcctttctcacccagaagcagaaagtt
ggggagctgaaggatgatgactttgagaaagtgtcggagcttggagcaggcaatggagga
gtggtgtttaaggtgtcccacaagccgactagcttgattatggccaggaagttaattcat
ctggagataaagcctgcaatcagaaatcagattatccgagagttgcaggttctgcatgaa
tgtaactccccatacattgtggggttctatggggccttctacagtgacggagagatcagc
atttgtatggaacacatggatggaggctcccttgatcaggttttgaagaaagctggcaaa
atccctgagaaaattttgggaaaagtcagcattgcagtgataaaaggtctaacctacctg
agagagaagcataagataatgcacagagatgtgaaaccttctaacatcctagtcaactct
aggggagagataaaactctgcgactttggagtcagcgggcagctaatagactccatggca
aattcctttgttgggacaagatcctatatgtcaccggagcggctacagggcactcattat
tctgtgcaatctgacatctggagcatggggctgtcacttgtggaaatggccataggaagg
tatcccattccaccacctgatgccaaagaactggaacttatctttgggtgttctgtagaa
ggggacccggcatcttctgaactggcgcctcgcccccggccacctggacgtccaatcagt
tcttatggtcctgatagtcgaccaccaatggccatttttgagcttctggattatatagtg
aacgagccacctccaaaattgcccagtggagtatttggagctgagttccaggactttgtg
aataaatgtcttgtgaagaatccagcagagagagcagatcttaaacagctaatggttcac
agcttcattaagcagtcagagttggaggaggtggattttgctggatggctttgttccact
atgggtcttaaacagcccagtaccccaacccatgccgctggagtgtga

DBGET integrated database retrieval system