KEGG   Xenopus tropicalis (western clawed frog): 493523
Entry
493523            CDS       T01011                                 

Gene name
txn2
Definition
(RefSeq) thioredoxin, mitochondrial
  KO
K03671  thioredoxin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04621  NOD-like receptor signaling pathway
xtr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493523 (txn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493523 (txn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    493523 (txn2)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   493523 (txn2)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_3 Thioredoxin_8 AhpC-TSA Thioredoxin_9 DSBA HyaE OST3_OST6
Other DBs
NCBI-GeneID: 493523
NCBI-ProteinID: NP_001008161
Xenbase: XB-GENE-943373
UniProt: Q641J6
Position
4
AA seq 170 aa
MAQRLFLKRVVVPSVKSLIAPAPSLSTCLSNGIRSHGLKTLTSSRLHPHCNLRPISTSTP
CRVTFNVQDADDFQERVVGSETPVVVDFHAQWCGPCKILAPRLEKVVAKQQGKVVMAKVD
IDDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLKKLIGP
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcccaacgcctgttcttgaagcgagttgttgttccgtctgtgaaaagcctaatcgct
ccagcaccctctctctccacttgcctctcaaatggcatacgatcacatggactcaagacc
ctgacctcctctagactacatccccactgtaacttgaggcccatctccacctctactcca
tgcagagttacattcaacgtccaggatgcagatgactttcaagagcgtgttgttggcagt
gagacacctgtggtggtggatttccatgcacagtggtgtgggccatgcaaaattctagct
ccccgattggagaaggttgttgctaagcaacaaggaaaagttgtgatggcaaaagtggat
atagatgaccatactgaccttgctcttgaatttgaggtctctgctgtgcccacggtcctg
gccataaaaaatggagatgttgtggataagtttgtgggactgaaggatgaagatcagctt
gacgctttcctgaagaaactcattggaccatag

DBGET integrated database retrieval system