KEGG   Xenopus tropicalis (western clawed frog): 493538
Entry
493538            CDS       T01011                                 

Symbol
cyct
Name
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00190  Oxidative phosphorylation
xtr01100  Metabolic pathways
xtr04115  p53 signaling pathway
xtr04210  Apoptosis
xtr05132  Salmonella infection
xtr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    493538 (cyct)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    493538 (cyct)
   04115 p53 signaling pathway
    493538 (cyct)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    493538 (cyct)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493538 (cyct)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 493538
NCBI-ProteinID: NP_001008176
Xenbase: XB-GENE-5931974
UniProt: Q640U4
Position
9
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKSTSE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggggacgttgaaaagggaaagaagatctttgtccagaagtgcgcacagtgccacaca
gtcgaaaagactggaaaacataagactgggccgaacctgtggggcctcttcggccgtaaa
actggacaagccccaggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaagataccctgtttgaatatttggagaacccaaagaaatatattcctggaaccaaa
atgatttttgctggcattaaaaagaagaatgagcgcgcagatctgatagcctatctaaag
aagtccacgtcagagtga

DBGET integrated database retrieval system