KEGG   Xenopus tropicalis (western clawed frog): 493538Help
Entry
493538            CDS       T01011                                 

Gene name
cyct, cycs, cyct-a, cyct-b
Definition
(RefSeq) cytochrome c, testis
  KO
K08738  cytochrome c
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04115  p53 signaling pathway
xtr04210  Apoptosis
xtr05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    493538 (cyct)
   04115 p53 signaling pathway
    493538 (cyct)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    493538 (cyct)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 493538
NCBI-ProteinID: NP_001008176
Xenbase: XB-GENE-5931974
UniProt: Q640U4
Position
9
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVW
GEDTLFEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKSTSE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgttgaaaagggaaagaagatctttgtccagaagtgcgcacagtgccacaca
gtcgaaaagactggaaaacataagactgggccgaacctgtggggcctcttcggccgtaaa
actggacaagccccaggattttcttacactgatgcaaacaaaagcaaaggcattgtctgg
ggagaagataccctgtttgaatatttggagaacccaaagaaatatattcctggaaccaaa
atgatttttgctggcattaaaaagaagaatgagcgcgcagatctgatagcctatctaaag
aagtccacgtcagagtga

DBGET integrated database retrieval system