KEGG   Xenopus tropicalis (western clawed frog): 496541Help
Entry
496541            CDS       T01011                                 

Gene name
txn, trx
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    496541 (txn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    496541 (txn)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   496541 (txn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin AhpC-TSA Thioredoxin_2 Thioredoxin_9 OST3_OST6 Thioredoxin_7 Thioredoxin_8 DIM1 Redoxin TraF HyaE
Motif
Other DBs
NCBI-GeneID: 496541
NCBI-ProteinID: NP_001011127
Xenbase: XB-GENE-5895392
UniProt: Q5XGB5
Position
1
AA seq 105 aa AA seqDB search
MVKYLASVEEYQCALKDAGEKLVVIDFTAKWCGPCQRIAPDFEKLSTEFPDIVLYKVDVD
DASDVAQVCGISSMPTFIFFKSGKQVERFSGADIKKLKETIKRLC
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggttaagtacctcgccagcgtggaggaataccaatgcgctctgaaagatgctggtgag
aagcttgtggtaatagattttactgcaaaatggtgtggcccgtgccaaagaattgcccca
gattttgaaaagctaagcactgagtttcctgatattgtgctgtacaaagtggatgtggat
gatgcatcagatgtagctcaagtctgtggaattagctccatgccaacattcattttcttc
aagtctggcaaacaggtggagcggttcagtggtgctgatataaagaaactgaaagaaaca
atcaaaaggttatgctga

DBGET integrated database retrieval system