KEGG   Xenopus tropicalis (tropical clawed frog): 496558
Entry
496558            CDS       T01011                                 
Symbol
zbtb17
Name
(RefSeq) zinc finger and BTB domain-containing protein 17
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    496558 (zbtb17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    496558 (zbtb17)
   04121 Ubiquitin system [BR:xtr04121]
    496558 (zbtb17)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    496558 (zbtb17)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     496558 (zbtb17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-C2H2_6 zf-Di19 zf-C2HC_2 zinc_ribbon_15 zf-H2C2_5 zf-C2H2_3rep zf_UBZ zf-C2HE HypA zf-BED
Other DBs
NCBI-GeneID: 496558
NCBI-ProteinID: NP_001011141
Xenbase: XB-GENE-940673
UniProt: Q5XGF0 A0A803K9W4
Position
7:131545921..131564502
AA seq 802 aa
MAAMDFPQHSHLVLEQLNQQRQLGLLCDCTFVVDGIDFKAHKAVLAACSQYFRMLFVEQK
DVVHLDISNAAGLGQVLEFMYTARLSLTRENVEDVLAVAGFLQMQEIVNACTALKSLSMP
AGASASCLGSLTPAQGDAAQTEGAVSGSGNPVEECGAAPVLYQHGGHSEEAGAEDLPGGA
KEEANGKALPQNQAAWHVPAGEKGAPGLAEEILAPTRVAKAETPAEQEVSCEQGQAGPTP
PAGQTDKLGAQEEGEGQTEEDPGSENREATEENELATDSGDSQHLGSGATPYPDRNESRP
YGSTTHKCKYCGKEFTHTGNYTRHIRTHTGEKPFSCRECNKAFSDPAACRAHEKTHSPLK
PYGCEDCGKSYRLVSLLNLHKKRHTGDARYRCTDCNKHFTTSGNLKRHQLVHSGEKPYHC
EYCNRPFSDPTSKMRHLETHDTNKEHKCPHCDKKFNQLGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCVHCKRKFADPGALQRHVRTHTGEKPCLCMICGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCNKAFVNVGD
LTKHVIIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQGKAGMKVLEREEGELDEDEVNI
VTVASDEMVTLTTETIAATAVTELTVVPVTTSVAADETEALKAEISKAVKQVQEADPNTQ
ILYACDSCGEKFLDANSLAQHVRMHTAQALVMFQADTDFYQQYSAPTTWHTEQVIQSGEL
IFRARDGADEHPQAVDCQSPVE
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggcagccatggatttcccccagcacagccacctggttctggagcagctaaaccagcag
aggcagttggggctcctgtgcgactgcaccttcgtggtggacgggatcgactttaaggcc
cacaaagccgtgttggccgcctgtagccagtacttcaggatgttgtttgtggagcagaag
gacgtggtgcatctggatatcagcaacgccgcaggtctgggccaggttctggagttcatg
tacactgcgcggctcagcctgacccgggagaatgtagaggacgtcctcgctgtggccggg
ttcttgcaaatgcaggagattgttaatgcctgtactgccctgaaatctctcagtatgccc
gcgggggcaagtgccagctgcctggggagcctcacaccggcacagggtgacgctgcgcag
acggagggggcagtttcaggctcggggaacccagtggaggaatgtggtgcagctccagtt
ttataccaacatggtgggcacagcgaggaagccggtgcagaggacctcccaggtggggct
aaggaagaagccaatgggaaagcgctgccccagaaccaagcagcctggcacgtccctgct
ggggagaagggagcacccggattggcagaggagatattggcccccaccagggtagcaaag
gcggagactccggcggagcaggaagtgagctgtgagcagggacaggcgggccccactccc
ccggcaggacagacagacaagctgggggcgcaggaggagggggaagggcagactgaggag
gatcctgggagtgagaacagggaggcgacagaggaaaatgaattggccacagactcgggg
gattcccagcacctgggatctggcgcaactccctacccggatcggaatgagtcccggccc
tacggctccactactcacaagtgtaagtactgtggcaaagaattcacccatacgggcaac
tacacccggcacatccgcacccacactggggagaagcccttctcctgccgcgagtgcaac
aaggcgttctccgacccggcggcctgccgagcccacgagaagactcacagccccctgaaa
ccgtacggctgcgaggactgcgggaagagctaccgcctcgtcagcctcctcaatctgcac
aagaagcgccacacgggggacgcccgctaccgctgcaccgactgcaacaagcattttacc
acctcgggcaacctgaagcgccaccaactggtccacagcggggagaaaccgtaccactgc
gagtactgcaaccggcccttctccgaccccacctccaaaatgcgccacttagagacgcac
gacactaacaaggagcacaagtgcccccactgcgacaaaaagttcaaccaactgggaaac
ctgaaagcccacctgaagattcacatagccgacggccccctgaaatgcagagaatgcggg
aagcagtttaccacgtcagggaacctgaagagacacctgcggatacacagcggggagaag
ccgtacgtgtgtgtgcactgcaagaggaagtttgcggatcccggagcgctgcagcgccac
gtccggactcacaccggggagaagccgtgcctgtgtatgatctgcggcaaagccttcacc
caggccagctccctaatcgcccacgtgcgccagcacaccggggagaagccgtacgtctgc
gagcgctgcgggaagaggtttgtgcagtcgagccagctggccaatcacatccgccatcac
gacaacattcggccgcacaagtgcagtgtgtgtaacaaagccttcgtcaatgtgggggac
ctgaccaagcacgtcatcatccacaccggagagaagcccttcctgtgtgacaagtgtggc
cggggctttaaccgagtggacaatctccgctcccacgtgaagacggtgcatcaggggaag
gcggggatgaaggtgctggagcgagaggagggggagctggacgaggacgaggtgaatatc
gtgacggtggcgtctgatgagatggtcactttaaccacggagaccatcgccgccacggcc
gtgacagaactcacagtggttccggtcaccacgtcggtggcagccgatgagacggaagcg
cttaaggcggagatcagcaaggcggtgaaacaggtgcaggaagcagatcccaacacccag
atactgtacgcctgcgactcgtgcggggagaagttcctggacgccaacagcttggcgcaa
cacgtgcgaatgcacacggcccaggcgctggtcatgttccaggccgacacggacttttac
cagcagtacagcgcccccaccacgtggcacaccgagcaggtcatacagtccggggagctc
atattccgcgcgcgggacggggccgacgaacacccccaggctgtcgattgccagagcccg
gtggaatag

DBGET integrated database retrieval system