KEGG   Xenopus tropicalis (western clawed frog): 496628
Entry
496628            CDS       T01011                                 

Gene name
pomgnt2
Definition
(RefSeq) protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 precursor
  KO
K18207  protein O-mannose beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.312]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00515  Mannose type O-glycan biosynthesis
xtr01100  Metabolic pathways
Module
xtr_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    496628 (pomgnt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xtr01003]
    496628 (pomgnt2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.312  protein O-mannose beta-1,4-N-acetylglucosaminyltransferase
     496628 (pomgnt2)
Glycosyltransferases [BR:xtr01003]
 Glycan extension
  O-Glycan
   496628 (pomgnt2)
SSDB
Motif
Pfam: DUF563
Other DBs
NCBI-GeneID: 496628
NCBI-ProteinID: NP_001011203
Xenbase: XB-GENE-973748
UniProt: Q5NDE6
Position
6
AA seq 576 aa
MNISAVFNALLVSIMAAVLWKHVKLLEQFYVIEEELELTRQSQELSQVRIDYQAALQALV
EDGTRMVCSGRMHTDRVCRFESLCYSTEAEEFVFFHSNSSIMLPNLGPRRFQPALLDLSS
VDDHNTQYFNFIELPAAALKFMPKPVFVPDVALIMNRFNPDNLMHVFHDDLIPIFYTIQQ
FADLDFESRLFFMEGWNEGLHFELYKFMSNKQPLLKEQLKTLGRLLCFTKSYVGLSKITT
WYQYGFVQPQGPKANILVSGNEIRHFAKFMMGKLNITKDQNAAEAYIVLFSRSMNRLIVN
EAELLLALAQEFQMKTITVSLEDHSFADIVRLISNATMLVSMHGAQLITSLFLPKGAIVV
ELFPYGVNPEHYTPYKTLSTLPGMELQYVAWQNTEEENTIAYPNRPWEQGGIVHLDKTEQ
ERIKKSKEVPRHLCCRNPEWLFRIYQDTKVNISSLIQVIKSKTKLGSRRQKWTQGLYPGK
VRESKCQASAQGTGEAKLFVSWQIPWNLKFLKVRDVKYEVWIQEQGENSYMPYILSQQNY
TFSENIKPLTTYLVWIRCIFNKTLLGPFAEVLVCNT
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaatatatcagcagtgttcaatgcgctgctcgtatccatcatggctgcagtgttgtgg
aaacatgtgaagttattagagcagttttatgtgattgaggaggagctggaactgactcgg
cagtctcaagagttgtcgcaagtgcgcattgattatcaggcagcattgcaagcgctagtg
gaagatggcaccagaatggtatgttctggtaggatgcatacagaccgtgtttgtcgcttt
gagtcactttgctactctacagaggctgaagagtttgtcttcttccatagtaactcctca
attatgttgcctaatttgggcccaagacgttttcagcctgcattgctagatttgtcttca
gttgatgaccacaacacacagtattttaactttatagagcttccagctgctgctttaaaa
ttcatgcctaagcctgtctttgtaccagacgttgcactgatcatgaacagatttaatcct
gataatttaatgcacgttttccacgatgaccttatccctattttctatactatacaacag
tttgcagacctagactttgaatctagactcttctttatggaaggatggaatgagggcttg
cattttgaactttataagttcatgagcaataagcagcccctgttaaaagaacaactgaaa
acactaggcagacttctttgtttcactaaatcttatgtggggctatcaaagatcacaaca
tggtatcagtatggttttgttcagccacaaggtccaaaagcaaacatactggtttcagga
aatgaaattagacactttgcaaaattcatgatgggaaaattaaacataactaaagatcaa
aatgctgcagaagcatatattgtcttatttagccgatcaatgaaccgactaattgtaaat
gaggcagagctgctcttggctcttgctcaggagtttcagatgaaaacgataacggtttcc
cttgaagaccattcatttgcagatattgtacggcttattagcaatgcaaccatgcttgtc
agcatgcatggtgcacaattaatcacgtctctcttcctaccaaaaggtgccattgtggta
gagcttttcccatatggtgtaaaccctgaacactacactccatacaaaacactgtcaaca
ctacctggtatggaactccaatatgttgcctggcagaatactgaagaggaaaatacaatc
gcttatcctaaccgaccatgggaacagggggggattgtgcacctagacaaaacagagcag
gaacgtataaagaagagcaaggaagtaccacgtcacctctgttgccgcaaccctgagtgg
ctttttcgtatttatcaggacacaaaagtcaacatttcttctctgattcaagttatcaaa
agtaaaacaaaacttggatctaggagacaaaagtggacacaaggactgtatcctgggaaa
gtgagggaatcaaaatgccaagcttctgcccagggtacaggtgaggccaagctgtttgtg
tcttggcagatcccctggaacctcaagttcctgaaagtaagagatgtaaaatatgaagta
tggatacaagaacaaggtgaaaactcttacatgccttatatcttatctcagcagaactac
actttttctgagaatattaaacctttaacaacttatttagtgtggatcagatgcattttc
aataaaacccttcttggaccctttgcagaggttttagtgtgcaatacataa

DBGET integrated database retrieval system