KEGG   Xenopus tropicalis (western clawed frog): 496687Help
Entry
496687            CDS       T01011                                 

Gene name
fkbp7
Definition
(RefSeq) FK506 binding protein 7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xtr03110]
    496687 (fkbp7)
Enzymes [BR:xtr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     496687 (fkbp7)
Chaperones and folding catalysts [BR:xtr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    496687 (fkbp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 496687
NCBI-ProteinID: NP_001107676
Xenbase: XB-GENE-977646
UniProt: A9ULL9
Position
9
AA seq 218 aa AA seqDB search
MHFFLTFLCFLQAFILLTVFSAEQKTDNEEEQVKIEVLHLPSECKQKSKKGDLVNAHYDA
FLAHNMTKLYCSRSSADGHPKWFVLGVGQVIKGLDMALMDMCSGEKRKAIIPPSLAYGQR
GHDKIPPNATLIFEIELYGITRGPRSSEAFHQIDLNNDKQLSKEEISHYLTEEFKRDGKQ
RDPSVHGTILTDIFQKNDHDGDGFISPKEYNVYSHDEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcttcttaacattcctttgctttctacaggcatttattctccttactgttttc
agcgcagaacaaaaaacagataatgaagaagagcaagttaagatcgaagtgctgcacctt
cccagcgaatgcaaacaaaagagcaagaaaggagaccttgtcaatgcgcattatgatgct
ttcctcgcccataatatgaccaaattgtattgcagtcgttcatcagcagatggccaccca
aagtggtttgttcttggcgttggacaagttattaaaggccttgatatggcactaatggac
atgtgcagtggagaaaaaagaaaagcgatcatccccccttcactggcttatggacaaaga
ggacatgataaaatcccacctaatgcaacactgatttttgaaatcgaactttacgggatc
acccgaggcccacgaagctcggaggcatttcatcaaatagatctgaacaatgacaagcag
ctgtcgaaagaggagataagtcattacttgacagaagaatttaagagagatggaaaacaa
agggacccatcggtccatggcacgatcttaacggatatattccaaaagaatgaccatgat
ggtgatggcttcatatctcctaaagaatacaatgtgtacagccacgatgagctatag

DBGET integrated database retrieval system