KEGG   Xenopus tropicalis (western clawed frog): 496693Help
Entry
496693            CDS       T01011                                 

Gene name
gstt1
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    496693 (gstt1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    496693 (gstt1)
   00982 Drug metabolism - cytochrome P450
    496693 (gstt1)
   00983 Drug metabolism - other enzymes
    496693 (gstt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    496693 (gstt1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     496693 (gstt1)
Transporters [BR:xtr02000]
 Other transporters
  Pores ion channels [TC:1]
   496693 (gstt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-GeneID: 496693
NCBI-ProteinID: XP_002931957
Position
1
AA seq 244 aa AA seqDB search
MSSSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKGEHLTQEFGKVSVLHKVPAL
KDGNFTMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTK
CVSPTILGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQV
IASGVNVFEERPKLGSWKQRLVEAVGEELFLEAHEWILSFSKQKFDPPPPELLQRLRSNP
LYNH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctcagaactcacactgtatctggacctcctatcacagccttgtcgttctgtc
tacatttttgccaaagcaaatagaattcctttcaactactgcaaactgcagctgctaaaa
ggggaacatctaactcaagagtttgggaaagtaagtgtattacataaagtgcctgcgctg
aaagatggcaacttcacaatggccgaaagcactgccatgctactttacctggctcgcaaa
tataaaacccccaatcactggtacccatcagatttacagaagcgtgcccgtgtagatgaa
taccttgcttggcagcacactaacacccgaccccatggctctaaggtgttttggaccaag
tgtgtatccccaactattctaggcaaggaagttcccagtgaaaaaatgaatgcagtaatg
gcagaatttgtcacaaccatgaacaattttgaagagaaattcctggggaacaaacccttc
attgctggggatgagatctctgtggcagacctggtggccattgtggagattatgcaggta
attgcaagtggtgtgaatgtgtttgaagagcggccaaagctgggatcctggaagcagcga
ctagtggaggctgtcggggaagagctgtttctagaggcgcatgagtggattctcagtttc
agcaaacaaaaatttgaccctcccccacctgagctgctgcagcgcctgagaagcaacccc
ctttataaccactga

DBGET integrated database retrieval system