KEGG   Xenopus tropicalis (western clawed frog): 496738Help
Entry
496738            CDS       T01011                                 

Gene name
rac2, en-7, hspc022
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04310  Wnt signaling pathway
xtr04370  VEGF signaling pathway
xtr04510  Focal adhesion
xtr04520  Adherens junction
xtr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    496738 (rac2)
   04310 Wnt signaling pathway
    496738 (rac2)
   04370 VEGF signaling pathway
    496738 (rac2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    496738 (rac2)
   04520 Adherens junction
    496738 (rac2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    496738 (rac2)
GTP-binding proteins [BR:xtr04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    496738 (rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 496738
NCBI-ProteinID: NP_001011285
Xenbase: XB-GENE-494950
UniProt: Q5M8J2
Position
4
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DDKETIEKLKEKKLSPISYPQGLALAKEIEAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PSRPNKAKCVVL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccattaaatgtgtagtggtgggcgatggagctgtgggtaaaacatgtcttctc
atcagttatacaaccaatgctttccccggggaatacatcccgactgtatttgacaattat
tcagcgaatgtgatggttgacagtaagcctgtaaacttgggtttatgggatacagctggc
caggaggactatgatcgactgagacctctctcctatccccagacagatgtgtttctgatt
tgcttttccctggtgagtccggcatcttatgagaacgtccgtgccaagtggtacccagaa
gtgagacaccattgtcccagcacacccatcattcttgttggaaccaagctggatctgcgg
gatgacaaagaaaccattgagaaacttaaagagaagaaactgtccccaatctcttaccca
cagggtttggctctggcaaaagagattgaggcagtcaaatacttggagtgctcagcctta
acgcaacgtggcctaaagacggtatttgatgaggctatccgagcggtgctgtgtccccct
ccttcgaggcctaacaaagccaaatgtgtggtgctttaa

DBGET integrated database retrieval system