KEGG   Xenopus tropicalis (western clawed frog): 496748Help
Entry
496748            CDS       T01011                                 

Gene name
ctsh
Definition
(RefSeq) cathepsin H
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 496748
NCBI-ProteinID: NP_001011295
Xenbase: XB-GENE-5820392
UniProt: Q5M8I1
Position
3
AA seq 259 aa AA seqDB search
MAMNHFADMTSEEMNSRNCFLPTHYPSKHKPAPRYNVKHAKISKGVDWRDSNCISPVKNQ
GYCGSCWAFATVGVLEALHCLNGNELHNLSEQQLVDCDPIDHGCCGGFPINAIDYITQEG
IMKSEDYEYEEKQFYCRYDSSNAIQLNVSKYYVLPNEENMASSVAKDGPITVGFGVNRDF
MLYSKGIFDGECAPSPNHAIIIVGYGTLHCEEGKDDGEDYWIIKNSWGTEWGEDGFGKIM
RNKDMCGISEFAASLELKP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaatcactttgctgatatgaccagcgaagaaatgaattcaaggaattgcttt
ctgcctacacattatccttcaaagcataaacctgctccccggtacaatgtgaaacatgct
aagatttctaaaggagttgactggagggattcaaactgtatcagtcctgttaaaaatcaa
ggatattgtggatcttgttgggcatttgcaacagttggtgttcttgaagcactccattgc
cttaatggcaatgaactccataatttgagcgagcaacaacttgtggactgtgatcccatc
gatcatggatgctgtgggggatttccaataaatgctatagattacattacacaggaagga
atcatgaaaagtgaagattatgagtatgaagagaagcaattctactgccgatatgattcc
agtaatgcaatacaactgaatgtttccaaatactatgttttgcctaatgaagaaaacatg
gcatcttctgttgctaaggatgggccaattactgttggatttggtgtgaatcgagacttt
atgttatacagtaaaggaatattcgatggagaatgtgcaccaagtccaaatcatgcaata
attatagtgggctatggcaccttgcattgtgaggaaggtaaagatgatggggaggactac
tggataataaaaaatagctggggcacggaatggggagaagatggttttggaaaaataatg
cgcaacaaagacatgtgtggcatctccgaatttgcagcctctctggaattgaaaccatga

DBGET integrated database retrieval system