KEGG   Xenopus tropicalis (western clawed frog): 496830
Entry
496830            CDS       T01011                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase precursor
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    496830 (rdh5)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     496830 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 496830
NCBI-ProteinID: NP_001011363
Xenbase: XB-GENE-1011657
UniProt: Q5M7P0
Position
2
AA seq 319 aa
MWCYVLLFAMVWAIGWLLRDRQKISRFSNKHVFITGCDTGFGNLLAKRLSRKGFQVLAGC
LTQAGADDLQKACPTGLKCTLLDVTSQESINKAVEWVKSEVGDRGLYGLVNNAGIANPIG
PTEWMTIQDYKRVMDVNAFGTIAVSLSFLSLIKKAQGRIINMASILGRISANGGGYCVSK
YAVEAFSDSLRRDMQHFGVRVCIIEPGFFKTAVTNLDSIERSLQLLWDQMPPETKMTYGD
KYFQQYLKVQRLIMNFICDADISKVPKCIEHALQARYPRTRYSPGWDAKLVWLPASYMPA
FITDAVLAFVLPKPKHSIH
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgttacgtgcttctctttgccatggtctgggccattggatggctgctaagggac
aggcagaagatttcaagattctcaaacaaacatgtctttattactggctgtgatactggc
tttggcaatttgctggccaagagactgagccgaaagggtttccaagtcctggccgggtgt
ctcactcaagcaggggcagatgacctgcagaaagcttgtcctactggccttaagtgcact
ttgctggatgttaccagtcaggaaagtataaacaaggctgtggagtgggtgaagtccgag
gtgggagatagaggtctctatgggttagttaacaatgctggaattgctaatcctattggg
cccactgaatggatgaccatacaggactacaagagagttatggacgtcaatgcatttgga
accattgctgtctcgctgagcttcctgtcactgataaagaaggcacaagggcgcattata
aatatggccagcatccttggaaggatttcagctaatggaggagggtactgtgtgtccaag
tacgcggttgaggccttctctgatagtttaaggcgggacatgcagcactttggcgtgaga
gtgtgtattattgagcctgggttcttcaagacagcagtgaccaacctggattctattgag
cgctccctgcagctactctgggatcagatgccgcctgagacaaagatgacctatggggac
aagtacttccaacaatacctgaaagtgcagagactcatcatgaacttcatctgtgatgcg
gatatctccaaagtgcccaagtgtatagaacacgccctgcaagcccgatacccacgcacc
agatacagtccaggctgggatgccaagctggtgtggctacccgcctcttacatgccagcc
ttcattacagatgctgtactggcttttgtacttcccaaaccaaagcacagcatccattag

DBGET integrated database retrieval system