KEGG   Xenopus tropicalis (western clawed frog): 548693
Entry
548693            CDS       T01011                                 

Symbol
mfsd5
Name
(RefSeq) molybdate-anion transporter precursor
  KO
K24175  MFS transporter, MFS domain-containing protein family, molybdate-anion transporter
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    548693 (mfsd5)
Transporters [BR:xtr02000]
 Major facilitator superfamily (MFS)
  Metal transporters
   MFS domain-containing protein family [TC:2.A.1.40]
    548693 (mfsd5)
SSDB
Motif
Pfam: MFS_5 MFS_1 Sugar_tr MFS_2 MFS_1_like DUF2157
Other DBs
NCBI-GeneID: 548693
NCBI-ProteinID: NP_001015939
Xenbase: XB-GENE-967131
UniProt: Q28E13 B7ZSY4
Position
2
AA seq 452 aa
MLLTAYFVLVGLIALWAVLEFSACHSKPSTSSNAVGNPAFRQFQYDFYRTYFPALAADWL
QGPYLYKLYQHYHFLEGQIAIIYVCGFGASVFAGLVSAPLTSRLGRRKSCILFCLLLSAS
YLCKLSQEYFVLITGRVLGGFSSSLLFSSFEAWYTHEHAEQHDFPAEWLPHTFTRAAAWN
GGIAIAAGVIANACAEWLGLGPASPSVLAVPLLVLSVALVIREWDENYGQTSSFRRVCGD
GLRCLLRDRRVLLLGTIQALFESVVYIFIFLWTPVLDPHNTPLGIAFSSFMAASAAGSSL
YRLATSKKYHLQPMHVLCLSILMVFFSLFMLTFSTAPGQEHPTESLLAFLLIELACGLYF
PAMGFLRCRLIPEKEQIGVLNWFRVPLNLLAGLGLLVLHDSDYQSGTRNMFSLCAITMLL
ALLCVVSLFTMVRNDSELRLPTSETEPNGTEQ
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgctgcttacagcatactttgttcttgtggggctgatagctctgtgggcagtgctggaa
ttttctgcctgtcattctaagccatcaacctccagcaatgctgtgggaaaccctgccttc
cgacaattccaatatgacttctatagaacttactttccagctctggcagcagattggttg
cagggcccatacctgtacaagttataccagcactaccacttcctggagggacaaatagct
atcatctatgtctgcggctttggggccagtgtgtttgcaggtctagtgagtgctccactg
acaagtcgacttggtcgcagaaaatcctgcatacttttttgccttctcctctcagcaagt
tacctgtgcaagctgtctcaggaatactttgtgcttattactggaagggttttgggtggc
ttctcaagctctctactcttttcttcctttgaagcatggtacactcatgaacatgctgaa
cagcacgattttccagctgagtggctcccccacacctttactcgggctgcagcctggaat
ggtggcatagcaatagctgctggagtaattgcaaatgcctgtgcggagtggctaggtctg
ggtcctgcttcaccctctgtgcttgcagtgcctcttctggttttatctgtagccctagtg
atacgtgagtgggatgaaaattatggacagaccagtagctttagaagagtatgtggagat
ggactgcgatgtcttctgagagaccgaagagtactgcttctgggtaccatccaggcatta
tttgagagtgtggtttatatattcatcttcctttggacaccagttctggatccacataat
acacctcttggcattgccttttctagctttatggcagctagtgcagcgggatcatcactg
tatcgtctggctacttccaagaaataccatttacagccaatgcatgtcctttgtctctca
attcttatggtattcttttccctcttcatgctgactttctccactgctccaggccaagag
catccaacagagtccttgttggcatttctactcatcgagttggcttgtggcctctacttt
cctgctatgggtttcctgaggtgcagattaatcccagagaaagagcagataggtgtattg
aactggtttagagttcctctgaacctgcttgctggattagggctgcttgtactgcatgac
agtgactaccaaagtggtaccaggaacatgttcagtttgtgtgccatcacaatgcttctt
gccctgctctgtgtggtaagcctcttcacaatggtgagaaatgactctgaactacggctt
ccaacctctgagacagagcctaatggaactgagcagtga

DBGET integrated database retrieval system