KEGG   Xenopus tropicalis (western clawed frog): 548715Help
Entry
548715            CDS       T01011                                 

Gene name
tgfbr1, TrR-1, aat5, acvrlk4, alk-5, alk5, lds1a, lds2a, skr4, tgfr-1, xTrR-1
Definition
(RefSeq) transforming growth factor beta receptor I
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04060  Cytokine-cytokine receptor interaction
xtr04068  FoxO signaling pathway
xtr04144  Endocytosis
xtr04218  Cellular senescence
xtr04350  TGF-beta signaling pathway
xtr04371  Apelin signaling pathway
xtr04520  Adherens junction
xtr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    548715 (tgfbr1)
   04350 TGF-beta signaling pathway
    548715 (tgfbr1)
   04371 Apelin signaling pathway
    548715 (tgfbr1)
   04068 FoxO signaling pathway
    548715 (tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    548715 (tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    548715 (tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    548715 (tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    548715 (tgfbr1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    548715 (tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    548715 (tgfbr1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     548715 (tgfbr1)
Protein kinases [BR:xtr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   548715 (tgfbr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 548715
NCBI-ProteinID: NP_001015961
Xenbase: XB-GENE-478587
UniProt: Q28E60
Position
6
AA seq 499 aa AA seqDB search
MSISSPCLRLPRLIVLLLIALARWAEALICHCEQCANRTCMTDGLCLVNVLIQDGKVTHN
SLCIADSERVPRDRPFMCFSTSTNGIYHNVECCQTDFCNKKLPAPSTSPSPRPPTNLGPV
ELAAVIAGPVCLVCILLMLVLYICHNRTVIHHRVPNDEDPSLDRPFISEGTTLKDLIYDM
TTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFR
EAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMLK
LSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDY
QLPYYDLVPSDPSVEEMKKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLT
ALRIKKTLSQLSQQEGLKM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatcgtctccttgtctaaggctgccaaggcttatcgtgctcttgttgattgca
ctggcacgctgggctgaggcactaatatgtcattgcgaacagtgtgcaaaccgtacctgt
atgaccgatggattgtgcttagttaatgtcctaattcaagatggcaaagtaacccacaac
agcttatgcattgctgactctgagcgtgtacctcgagacagaccatttatgtgtttttct
acttctacaaatggaatataccataatgttgagtgctgtcaaacggacttctgcaataag
aaattaccagctccctcaacttcaccatcacctaggcctcctacaaacttagggcctgtg
gagctggcagctgttattgctggcccagtttgccttgtttgcatcctgctgatgttggtc
ctttacatatgccataaccgcacagtcattcatcatcgagttcctaatgatgaagatcct
tcattagatcggccttttatatctgagggcacaacactaaaagatctcatttatgatatg
acaacttcaggttctggttcaggtctgcctttacttgtgcagagaacaattgcaagaaca
attgttttgcaagaaagcattggaaaaggtcgatttggtgaagtatggcgtggaaagtgg
aggggagaggaagtggcagtgaaaattttctcctcaagggaagagcgttcctggttccgt
gaggcagaaatatatcagacagttatgttgcgccatgagaacatacttggcttcattgca
gcagacaacaaagataatggcacatggactcagctatggttggtttctgattaccatgaa
catggatcactatttgattacctaaatcgttatacagtgactgtagaaggaatgttgaag
ctttctttatccactgctagtggtttagctcatcttcatatggagatagttggaacacaa
gggaaaccagctattgcccaccgagatttgaagtccaaaaatatactggttaagaaaaat
ggaacttgctgtattgctgacctgggtctggctgtcaggcatgattctgctacagataca
atagatattgcaccaaatcacagagttgggacaaaaagatatatggcaccagaggttttg
gatgactctattaatatgaaacattttgaatcgtttaagcgtgctgatatctatgcaatg
ggcctggttttctgggaaattgcgcgacgatgttctataggtggaatccatgaagattat
cagctaccttattatgaccttgtaccttctgacccatctgttgaagaaatgaaaaaagtg
gtttgtgaacagaaattgagaccaaacattccaaacaggtggcagagctgtgaagcactt
cgcgtgatggccaaaataatgcgtgaatgttggtatgccaatggagcagcacgtctaact
gctttacggatcaagaaaacgttgtcacaactaagccaacaggaaggccttaaaatgtaa

DBGET integrated database retrieval system