KEGG   Xenopus tropicalis (western clawed frog): 548722
Entry
548722            CDS       T01011                                 

Gene name
h2afx.2
Definition
(RefSeq) H2A histone family member X, gene 2
  KO
K11251  histone H2A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    548722 (h2afx.2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    548722 (h2afx.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    548722 (h2afx.2)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    548722 (h2afx.2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   548722 (h2afx.2)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 548722
NCBI-ProteinID: NP_001015968
Xenbase: XB-GENE-855944
UniProt: Q28E74
Position
7
AA seq 143 aa
MSGRGKTGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQTVLLPKK
TSAAPTATGKSSGKKSSQQSQEY
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtctggaagaggaaagactggcggcaaaaccagagctaaggccaagactcgctcatcc
agggctggtttgcagtttcctgtcggtcgtgtccatcgtttattacggaaggggaactac
gctgagcgcgtcggtgccggggcaccagtttatttggctgctgtattagaatatctgacg
gcagaaattctggagttggctgggaacgcggcccgggataataaaaagacccgtattatt
ccccgccacctgcagttggctgtgcgcaacgatgaagagctcaacaaactgctgggaggg
gtgaccattgcgcagggaggtgttttgcccaatatccaaaccgtgttgctacctaaaaag
acttccgcggctcctacagctacaggcaagagttccggcaagaagagttcccagcaatcc
caagaatattaa

DBGET integrated database retrieval system