KEGG   Xenopus tropicalis (western clawed frog): 548827
Entry
548827            CDS       T01011                                 

Gene name
zdhhc21
Definition
(RefSeq) palmitoyltransferase ZDHHC21
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    548827 (zdhhc21)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     548827 (zdhhc21)
SSDB
Motif
Pfam: DHHC DUF5079
Other DBs
NCBI-GeneID: 548827
NCBI-ProteinID: NP_001016073
Xenbase: XB-GENE-855474
UniProt: Q28F05
Position
1
AA seq 264 aa
MGLSIHFVVDPQGWCCVGAIFFIWFYNTLFIPKLILFPRFDEGQISVAAIWAYYLTSIFC
IISLLRASTADPGKLQDSPKIPLTEKELWELCNKCNMMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYTQLLSGYTLVLDFCHYYYFLPLAINWDIFIFRHELALLR
ISTFMGIVMFGGMCSLFYTQIMGILTDTTTIEKMANCCDEISRARKPWQQTFSEVFGTRW
KILWFIPFRRRQPLRVSYYFANHV
NT seq 795 nt   +upstreamnt  +downstreamnt
atgggtctgtctatccattttgttgttgaccctcagggatggtgctgtgttggagctatc
ttctttatctggttctacaatacactgtttattccaaagctgattctgtttccccgcttt
gatgagggacaaatttcagttgctgctatatgggcttactacttgacctctattttttgc
attatttcacttttgagagcctcaactgcagaccctggaaaactacaagatagtccaaaa
atccctcttacagagaaagaattatgggaattatgtaacaaatgtaatatgatgagacca
aagcgatcccaccactgcagtcgctgtgggcactgtgtcagaagaatggatcaccactgt
ccatggattaacaactgtgttggagaagacaaccactggctgttccttcagctctgtttc
tacactcaacttctgagtggctacactttggtcctggatttctgccactattattacttt
ttgccactagccattaactgggatatcttcatatttagacatgaactggccttgcttagg
atatccacttttatgggtattgtcatgtttggaggcatgtgcagtcttttctacacgcaa
ataatgggcatattgacggacacaacaactatagaaaaaatggcaaactgctgtgatgaa
atatcgagagctcgaaagccatggcagcagaccttctcagaagtttttggcactcgctgg
aagatcctgtggttcattcctttcaggcggaggcaaccactgcgcgtctcctactacttt
gccaatcatgtctaa

DBGET integrated database retrieval system