KEGG   Xenopus tropicalis (western clawed frog): 548926
Entry
548926            CDS       T01011                                 

Gene name
rps27a
Definition
(RefSeq) ubiquitin-40S ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03010  Ribosome
xtr04120  Ubiquitin mediated proteolysis
xtr04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    548926 (rps27a)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    548926 (rps27a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    548926 (rps27a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xtr03011]
    548926 (rps27a)
   04121 Ubiquitin system [BR:xtr04121]
    548926 (rps27a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    548926 (rps27a)
Ribosome [BR:xtr03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    548926 (rps27a)
  Archaea
    548926 (rps27a)
Ubiquitin system [BR:xtr04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   548926 (rps27a)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   548926 (rps27a)
  Exosomal proteins of colorectal cancer cells
   548926 (rps27a)
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD DUF2407 Ubiquitin_5
Other DBs
NCBI-GeneID: 548926
NCBI-ProteinID: NP_001016172
Xenbase: XB-GENE-5741151
UniProt: Q28FM7
Position
5
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaaccctcacggggaagactatcaccctcgaggttgagccttct
gatactatagaaaatgtcaaggctaagattcaggataaggaaggtatccctcctgatcag
cagaggttgatctttgctgggaagcagctggaagatggccgtactctctccgattataac
atccagaaggagtcaactctccaccttgtgctgaggctccgtggtggtgctaagaagagg
aagaagaagtcttacaccacccccaagaagaacaagcataagagaaagaaggtcaagctt
gctgtgcttaagtattacaaggttgatgaaaacggaaaaatcagccgcctgcgacgtgaa
tgcccttcagacgaatgtggcgccggtgtcttcatggctagtcacttcgacagacattac
tgcgggaaatgctgtctgacatactgcttcaacaaaccagaggataaataa

DBGET integrated database retrieval system