KEGG   Xenopus tropicalis (western clawed frog): 549025
Entry
549025            CDS       T01011                                 

Gene name
id3
Definition
(RefSeq) DNA-binding protein inhibitor ID-3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    549025 (id3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    549025 (id3)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    549025 (id3)
SSDB
Motif
Pfam: HLH Clavanin
Other DBs
NCBI-GeneID: 549025
NCBI-ProteinID: NP_001016271
Xenbase: XB-GENE-495261
UniProt: Q688C4
Position
2
AA seq 118 aa
MKAISPVRSMSSCYQAVCCLSEQSLSIARGSSHKGPGVDEPMGLLYDMNGCYSKLKELVP
GIPQGSKLSQVEILQHVIDYIFDLQIVLGEDQQQNSILNLQKSDFSELATQGDASVCH
NT seq 357 nt   +upstreamnt  +downstreamnt
atgaaagccatcagcccagtgaggtccatgtcaagctgctaccaggctgtctgttgcttg
tctgagcagagtctaagcattgccaggggcagcagccataagggaccaggtgtggatgag
cccatgggacttctgtacgatatgaacggctgctactccaaactaaaagagttggtgcca
gggatcccccaaggaagcaagctcagccaagttgagattctgcagcatgtcatcgactac
atctttgacctgcagatagtcctgggggaagatcagcaacaaaacagcatccttaacttg
cagaaatctgatttctcagaattggcaacacaaggggacgccagtgtctgccactga

DBGET integrated database retrieval system