KEGG   Xenopus tropicalis (western clawed frog): 549113
Entry
549113            CDS       T01011                                 

Gene name
bud31
Definition
(RefSeq) protein BUD31 homolog
  KO
K12873  bud site selection protein 31
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    549113 (bud31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    549113 (bud31)
Spliceosome [BR:xtr03041]
 Complex B
  Other components
   Prp19-related factors
    549113 (bud31)
 Complex C
    549113 (bud31)
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 549113
NCBI-ProteinID: NP_001016359
Xenbase: XB-GENE-961904
UniProt: A4IHH6
Position
9
AA seq 144 aa
MPKVKRSRKPPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYDYCIREGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKTKLEVGRIIECTHCGCRGCSG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgccaaaagtgaagcggagcagaaagcctccaccagatggttgggagctcattgagcca
accttggatgaacttgaccagaaaatgagagaagcggaaactgagcctcacgagggaaaa
agaaaagtggagtccttgtggcctatcttcaggattcatcatcagaaaactcgctatata
tttgacctattttacaagagaaaagccatcagtagagagttatatgattactgcatcaga
gaaggatatgctgataagaaccttattgcaaaatggaagaagcaggggtatgaaaacctt
tgttgcctgcgttgtatacagacaagagacaccaactttggaaccaattgtatttgcagg
gtcccaaaaaccaaactggaagtgggaaggatcattgaatgcacacactgtggctgcaga
ggatgctctggataa

DBGET integrated database retrieval system