KEGG   Xenopus tropicalis (western clawed frog): 549182Help
Entry
549182            CDS       T01011                                 

Gene name
tyw3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xtr03016]
    549182 (tyw3)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     549182 (tyw3)
Transfer RNA biogenesis [BR:xtr03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    549182 (tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 BTG
Motif
Other DBs
NCBI-GeneID: 549182
NCBI-ProteinID: NP_001016428
Xenbase: XB-GENE-5729629
UniProt: F7EK24
Position
4
AA seq 251 aa AA seqDB search
MEKQEAFSHWKQQSLRKADVSKKGSVDEDIEETVRLINQQERYFTTSSCSGRVIMINETL
DSSIIQKQNCSWLFVTHQLCKPDDVFAALKNATGDVVLKFEPFVLHVQCHKLEDAQILHG
VAINSGFRNSGITVGKKGKIIMAVRSTHGLEVPLTQNGKCLVSQEYIEFLVQTANRKMEE
NKRRITRFHSCLLKALQKGDCAHDAPSKEQAPSCVYVRRRKRKDRSRKSNCSSSEEEHSD
SEPELTLLNDP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacaggaggcattttcccattggaagcaacaatcattgcggaaagcagatgtc
agtaagaaaggcagcgtagatgaggatatcgaagagactgtgcggctgattaaccagcag
gagcgctatttcaccaccagctcatgctcggggagggtgatcatgatcaatgagactctg
gatagctctataatacagaagcagaactgttcctggctttttgtaacgcatcagctttgt
aaacctgatgatgtgtttgcagcgctaaagaatgctactggggatgttgtgctgaagttt
gaaccatttgtccttcatgtccagtgtcataaacttgaggatgcacagattctacatggt
gttgcaattaattctggcttcaggaattccggaatcactgttggaaagaaaggaaaaatt
ataatggcagtacgaagtacccatggcttggaagtccctctcacacaaaatgggaagtgt
ttggtaagccaagagtatatagaatttctggtgcagacagcgaataggaaaatggaagag
aataaaagacgaataaccaggtttcacagctgccttctgaaagctttacaaaaaggagac
tgcgcccatgacgctccatctaaggaacaagcgccaagttgtgtttatgttcgtagaagg
aaaagaaaagacagaagcaggaaatcaaactgttcttccagtgaagaggaacattctgat
tcagagcctgaactaacacttttaaatgacccctga

DBGET integrated database retrieval system