KEGG   Xenopus tropicalis (western clawed frog): 549348
Entry
549348            CDS       T01011                                 

Gene name
mrpl3
Definition
(RefSeq) 39S ribosomal protein L3, mitochondrial
  KO
K02906  large subunit ribosomal protein L3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    549348 (mrpl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xtr03011]
    549348 (mrpl3)
Ribosome [BR:xtr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    549348 (mrpl3)
  Bacteria
    549348 (mrpl3)
  Archaea
    549348 (mrpl3)
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 549348
NCBI-ProteinID: NP_001016594
Xenbase: XB-GENE-945435
UniProt: Q28I48 A0A7D9NL86
Position
6
AA seq 341 aa
MAVGMNWRLLCSVRKQLLNRVTAGTERNISCVFITRGIQSSTWWDEHLSEENKQFLKRVT
AEEYHAQTASKLCPLKDEPWPTKPWEPGSNRVGVIAVKLGMMPIWTKSGDRHAVTMLQVR
DCHVVKYTPKEEFDGKTASLTVGGKNVSPFYKPESAMELYREAGVPPKQKISIFKVSDNA
ILKPGTPLYAAHFRPGQFVDITAKTIGKGFQGVMKRWGYKGQPASHGQTKTHRRPGAISS
GDPARVFPGTKMPGRMGNVYRTSYALKVWRVNTKHNIIYVNGSVPGHTNCLVKVTDTKLH
GKKLSENLPFPTYFADGDEELPEDLYDDEVFQFSEPSVKYV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcggtgggaatgaattggaggttactgtgtagcgtccggaagcagctgctgaataga
gtcactgcgggtacagagagaaatatctcctgtgtatttataaccagaggtatccagagc
agcacttggtgggatgaacatctctctgaagaaaacaaacaatttctaaaacgtgtgact
gcagaagagtatcatgctcaaacagcaagcaagctttgccctctaaaagatgaaccttgg
cccacaaagccatgggaacctggttccaacagggttggtgtgattgcagtcaagttagga
atgatgccgatatggactaaatctggagatagacatgctgtcaccatgctacaagttcgt
gactgtcatgtcgttaaatatacacctaaggaggaatttgatggaaaaactgcatctctc
actgtaggaggaaaaaatgtatccccattttataaaccagaatctgcaatggaattgtat
cgagaagctggagtgcctccaaagcaaaaaatcagcatatttaaagtgtccgataatgct
atacttaagccagggaccccactttatgctgcacatttccgtcctgggcagtttgtggac
atcacagcaaaaacgattggtaaaggatttcaaggtgtgatgaaaaggtgggggtataaa
ggtcagccagcttcccatgggcagactaaaacacaccggagacctggagccatatcttca
ggggatccagctcgcgtgtttcctggaacaaagatgcctggaagaatgggtaatgtctac
aggacatcatatgcccttaaggtttggagagtgaataccaagcacaatatcatttatgtg
aatggttctgttccagggcataccaactgtttagtaaaggtcaccgacacaaaattgcat
ggtaaaaaactcagtgaaaacctcccattccctacatattttgctgatggagatgaagaa
ttaccagaagatttatatgacgatgaagttttccagttcagcgaaccctcagttaaatat
gtttga

DBGET integrated database retrieval system