KEGG   Xenopus tropicalis (western clawed frog): 549546
Entry
549546            CDS       T01011                                 

Gene name
dck.2
Definition
(RefSeq) deoxycytidine kinase, gene 2
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr00240  Pyrimidine metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    549546 (dck.2)
   00240 Pyrimidine metabolism
    549546 (dck.2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     549546 (dck.2)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 AAA_17 Thymidylate_kin Hrs_helical
Other DBs
NCBI-GeneID: 549546
NCBI-ProteinID: NP_001016792
Xenbase: XB-GENE-5727742
UniProt: Q28D85
Position
3
AA seq 264 aa
MATPPKRMCHSPVFNNSFEKRFKKLSVEGNIAAGKSTFVRILEKANDEWEVVPEPIAKWC
NVQTTGNEDEELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVRAQLNPPSHKLREA
EHPVQFFERSVYSDRYVFASSLFESQNINETEWAIYQDWHTWLLNQFESDIDLDGIIYLR
ATPEKCMDRIHTRGRDEEQGIELEYLESLHYKHESWLYDRTIQVDFENLQHMPVLVLDVN
EDFKNDKIKQEALLDKVKEFLASL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgactcccccgaagagaatgtgtcacagccctgtctttaacaacagctttgagaaa
aggtttaagaagctttccgtagaaggcaatattgctgccgggaaatccacgtttgtgcga
atacttgaaaaggctaacgacgagtgggaggttgttccagagccaattgccaaatggtgc
aatgtccaaaccaccggaaatgaagatgaggagctgtccacatctcagaagagcggagga
aatttgctacaaatgctgtacgataaacctacccggtgggcttacacatttcaaacgtat
gcttgccttagcagagtgagggcacagcttaatccaccgtcccataagttacgtgaagca
gaacatcctgtgcagttttttgaaagatctgtgtacagcgataggtatgtttttgcttcc
agcttatttgaatctcaaaacattaatgaaacagagtgggccatatatcaagactggcat
acatggctcctaaatcagtttgaatccgacattgacttggatgggataatctacctcaga
gcaacaccagagaaatgtatggataggatacacactcgaggtagagatgaggagcaagga
attgaactcgaatacttggaaagtttacactataagcacgaatcttggctttatgacagg
acaattcaggtagattttgaaaacctgcagcacatgccagttctggttttggatgtcaat
gaagacttcaaaaatgacaaaatcaaacaggaggcattgcttgacaaagtaaaggaattt
ttggcttccctctaa

DBGET integrated database retrieval system