KEGG   Xenopus tropicalis (western clawed frog): 549712
Entry
549712            CDS       T01011                                 

Gene name
ctnnb1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04310  Wnt signaling pathway
xtr04510  Focal adhesion
xtr04520  Adherens junction
xtr04916  Melanogenesis
xtr05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    549712 (ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    549712 (ctnnb1)
   04520 Adherens junction
    549712 (ctnnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    549712 (ctnnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    549712 (ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 549712
NCBI-ProteinID: NP_001016958
Xenbase: XB-GENE-487200
UniProt: Q28GC2
Position
6
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEDEDVDTN
QVLYEWEQGFSQSFTQDQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDSSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMPWNEAADLGLDIGAQGEPLGYRQDDPSYRSFH
APGYGQDAMGMDSMMDHDMAGHHPGADYPVDGLPDLSHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggcaactcaagcagatctaatggagctggatatggccatggagccagatcggaaagca
gcagtcagtcactggcagcagcagtcttacctggattctggtatccattctggagcgacc
accacagcaccatctttaagtggcaaaggaaacccagaggatgaagatgtggacaccaac
caagttttgtatgaatgggagcaaggtttctctcagtcctttactcaagatcaagtggct
gatattgatggccaatatgctatgacaagagcccagcgagttcgtgctgcaatgtttcca
gaaacccttgatgaaggcatgcagattccatcaacgcaatttgactctgcacaccctaca
aatgtgcaacgcttagcagaaccttcccagatgcttaagcatgctgtggtcaacttgatc
aattaccaagatgatgctgaactggctactcgagcaatccctgagctgacaaaacttctt
aatgatgaggaccaggttgtagttaacaaggctgctgtaatggttcaccaactgtcaaag
aaggaagcatcacgccatgctataatgcgttcaccacagatggtttccgcaatagttcgt
acaatgcagaatacaaatgatgtagaaacggcacgatgcactgcaggaacacttcacaac
ctttctcaccatcgtgaaggcttgttggctatctttaaatctggaggcattcctgctctg
gttaaaatgcttggctccccagttgattctgtactgttctatgccatcacaacactgcac
aatcttcttcttcaccaagaaggagcaaagatggctgtacgcctagctggtggcttgcag
aaaatggttgcccttctcaataaaacaaatgtcaagtttttggcaatcacaacagactgt
cttcaaatattggcctatggaaatcaagaaagcaagttgattattcttgcaagtggtgga
ccgcaagctttggtaaacataatgaggacttacagttacgagaaacttctgtggaccaca
agtcgggtgcttaaagtgttatctgtgtgctctagcaacaagcctgctatagttgaagct
ggtggaatgcaagctttaggactccatcttacagactcaagccaacgtcttgttcaaaat
tgtctttggactctaagaaacctttcagatgccgcaactaaacaggagggaatggaaggt
cttcttggaaccctggttcagcttcttggatcagatgacattaatgtagtaacttgtgca
gctggtatactgtccaaccttacatgcaacaactacaaaaacaaaatgatggtttgtcaa
gttggaggcattgaagcccttgttcgcacagttctacgtgctggggatagagaagacatc
actgaacctgcaatttgtgcacttcgtcaccttaccagtaggcatcaggaagcagagatg
gctcaaaatgcagtacgtcttcattatgggcttccagtggtggtgaagctcttgcaccct
ccttcacactggcctttgataaaggctacagttggcctgatccgcaaccttgctctttgt
ccagccaatcatgccccactgcgcgagcagggtgctattcctcgacttgtgcaattgctt
gttcgtgcacaccaggacacacagaggcgcacttcaatgggtggaacacaacagcaattt
gtggagggtgtccgtatggaagagatagttgaaggctgcacaggtgcccttcacattttg
gctcgtgatgtccacaaccgaattgtaatcagaggtcttaacaccattccattatttgtg
cagttgctgtactctcctattgaaaacatccaaagagtggcagcaggtgtactttgtgaa
ctggcacaagacaaagaggctgctgaagctattgaagctgaaggtgcaactgctcctctt
actgaactgcttcactctagaaatgaaggagttgcaacttatgcagctgctgttctgttc
cgtatgtctgaggacaaaccccaggactacaagaagcgtctctcagtggagttaacaagc
tcactcttcagaacagagccaatgccatggaatgaggctgcagaccttggtcttgatatc
ggtgcccaaggtgaacctcttggctacagacaggatgatccaagctacagatctttccat
gcccctggctatggccaggatgcaatgggtatggactcaatgatggatcatgacatggca
ggtcatcacccaggtgcagactatccagttgatggacttcctgatttgagtcatgcccaa
gatcttatggatggcctgcctccaggtgatagcaaccaactggcctggtttgacactgac
ttgtaa

DBGET integrated database retrieval system