KEGG   Xenopus tropicalis (western clawed frog): 549881Help
Entry
549881            CDS       T01011                                 

Gene name
mapk1, erk, erk2, ert1, mapk, mapk1-a, mapk1-b, mapk2, mpk1, p38, p40, p41, p41mapk, p42mapk, prkm1, prkm2, xp42
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04114  Oocyte meiosis
xtr04140  Autophagy - animal
xtr04150  mTOR signaling pathway
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04261  Adrenergic signaling in cardiomyocytes
xtr04270  Vascular smooth muscle contraction
xtr04350  TGF-beta signaling pathway
xtr04370  VEGF signaling pathway
xtr04371  Apelin signaling pathway
xtr04510  Focal adhesion
xtr04520  Adherens junction
xtr04540  Gap junction
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04810  Regulation of actin cytoskeleton
xtr04910  Insulin signaling pathway
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04916  Melanogenesis
xtr04933  AGE-RAGE signaling pathway in diabetic complications
xtr05132  Salmonella infection
Module
xtr_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    549881 (mapk1)
   04012 ErbB signaling pathway
    549881 (mapk1)
   04350 TGF-beta signaling pathway
    549881 (mapk1)
   04370 VEGF signaling pathway
    549881 (mapk1)
   04371 Apelin signaling pathway
    549881 (mapk1)
   04068 FoxO signaling pathway
    549881 (mapk1)
   04150 mTOR signaling pathway
    549881 (mapk1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    549881 (mapk1)
  Cell growth and death
   04114 Oocyte meiosis
    549881 (mapk1)
   04210 Apoptosis
    549881 (mapk1)
   04218 Cellular senescence
    549881 (mapk1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    549881 (mapk1)
   04520 Adherens junction
    549881 (mapk1)
   04540 Gap junction
    549881 (mapk1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    549881 (mapk1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    549881 (mapk1)
   04621 NOD-like receptor signaling pathway
    549881 (mapk1)
   04625 C-type lectin receptor signaling pathway
    549881 (mapk1)
  Endocrine system
   04910 Insulin signaling pathway
    549881 (mapk1)
   04912 GnRH signaling pathway
    549881 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    549881 (mapk1)
   04916 Melanogenesis
    549881 (mapk1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    549881 (mapk1)
   04270 Vascular smooth muscle contraction
    549881 (mapk1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    549881 (mapk1)
  Infectious diseases
   05132 Salmonella infection
    549881 (mapk1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     549881 (mapk1)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   549881 (mapk1)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     549881 (mapk1)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   549881 (mapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 549881
NCBI-ProteinID: NP_001017127
Xenbase: XB-GENE-479467
UniProt: Q28H11
Position
1
AA seq 361 aa AA seqDB search
MAAAGASSNPGGGPEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKIS
PFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFN
PHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPG
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcaggggcctcgtctaaccccggcggggggccggagatggtgcgagggcag
gcgttcgacgtaggcccgcgatataccaacctgtcatatatcggggagggagcgtacggc
atggtttgttctgcctatgacaatgtaaacaaagtacgagttgctatcaagaaaatcagc
ccatttgagcatcagacatactgccagagaacactgagggagatcaaaatcttgctgcgt
tttaagcatgaaaacatcattggaattaatgacataattcgagctccaaccattgagcaa
atgaaagatgtgtatattgtgcaggatctcatggagacagatctctataaactcctgaag
actcagcatcttagcaatgaccacatctgctatttcttgtaccagatcctgagaggatta
aagtacatccattcagccaatgttctacatcgtgatcttaagccttcaaatttgctgctt
aacactacctgtgatcttaagatttgtgattttggattggctcgtgttgcagacccagac
catgatcacactggatttctcacagaatatgtagccactcgctggtacagagctcctgag
atcatgctgaattccaagggctataccaaatcgattgacatctggtctgttggctgcatt
cttgctgagatgctttctaatagacccatatttcctggaaaacattatcttgaccaactc
aatcacatacttggaattcttggatctccatctcaagaggacctaaactgtataatcaat
ttaaaagctaggaattacttgctttcccttcctcacaaaaataaggtgccatggaacaga
cttttccctaatgcagatcctaaagctctagatttattggacaagatgttgaccttcaac
ccccacaaaagaattgaagtagaggcagctttggctcatccctatctggaacaatattat
gacccaagtgatgagcctgtagctgaagctccctttaaatttgaaatggagcttgatgat
ttgcccaaggagacactgaaggagctaatttttgaagaaacggctagattccagccaggg
tactga

DBGET integrated database retrieval system