KEGG   Xenopus tropicalis (western clawed frog): 549894
Entry
549894            CDS       T01011                                 

Gene name
prpf38a
Definition
(RefSeq) pre-mRNA-splicing factor 38A
  KO
K12849  pre-mRNA-splicing factor 38A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    549894 (prpf38a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    549894 (prpf38a)
Spliceosome [BR:xtr03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    549894 (prpf38a)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    549894 (prpf38a)
SSDB
Motif
Pfam: PRP38 PRP38_assoc
Other DBs
NCBI-GeneID: 549894
NCBI-ProteinID: NP_001017140
Xenbase: XB-GENE-979997
UniProt: Q28H87 B0JYW3
Position
4
AA seq 312 aa
MANRTVKDAHSVHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELKYVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRTLGALYMRLTGTATDCYKYL
EPLYNDYRKVKVQNRNGEFELMHVDEFIDQLLHEERVCDVILPRLQKRFVLEETEQLDPR
VSALEEDMDDVESSEEEEDEDEKGRDPSPEHHRRNYRDLDRPRRSPSPRYRRSRSRSPRR
RSRSPKRRSPSPPRRERHRSKSPRRHRSRSRERRHRSKSKSPGHHRSHRHRSHSKSPERS
KKSHKKSRRGNE
NT seq 939 nt   +upstreamnt  +downstreamnt
atggcgaatcggactgtgaaagacgctcatagtgtgcatgggactaaccctcagtatttg
gtggagaagattatcaggactcgcatatatgaatcgaagtattggaaagaagaatgtttt
gggttgacagctgagttggtggttgataaggccatggaacttaaatatgttggaggtgtt
tatggtggaaacataaaaccaacccctttcctctgcttgaccttgaagatgctacagatt
cagcctgaaaaagacatcattgtggaattcataaaaaatgaagacttcaagtatgtgcga
accttgggtgccctgtacatgcggttaaccggcactgccactgactgctacaaatacttg
gagcctctttataatgattacagaaaagttaaagtccaaaacaggaatggagaatttgaa
ctgatgcacgtggatgagttcatagatcagctactacatgaggagcgtgtctgtgatgtc
atattaccacggttacagaaacgctttgttctggaagaaacagaacagttagatccaaga
gtcagtgcactggaagaagacatggatgatgtggagtccagtgaagaggaagaggatgag
gatgaaaagggtagagatccttctcccgaacatcacagaagaaattatagagaccttgac
agaccacgtagatctccctctcctcgttacagaagaagccgtagtcgttcaccaagaaga
cgcagtcgctctcctaaaaggagaagtccttctccacctcgtcgggaaagacataggagc
aaaagcccaaggcgtcatcggagtaggtctagagagagacgacaccgatccaaatccaaa
tctccaggacatcatcgaagtcacaggcacagaagtcactccaagtcacctgagaggtca
aagaaaagtcataagaagagcagaagagggaatgagtaa

DBGET integrated database retrieval system