KEGG   Xenopus tropicalis (western clawed frog): 549929
Entry
549929            CDS       T01011                                 

Gene name
cenpm
Definition
(RefSeq) centromere protein M
  KO
K11505  centromere protein M
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    549929 (cenpm)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     549929 (cenpm)
SSDB
Motif
Pfam: CENP-M
Other DBs
NCBI-GeneID: 549929
NCBI-ProteinID: NP_001017175
Xenbase: XB-GENE-966035
UniProt: A4IHL0
Position
4
AA seq 180 aa
MATLRPFDKMPMLNAAALLLVGTEESHREQLASAMLKEPKTFEVKIHMAQSLPLPYEREH
LRPRFDMVVFLINLHSQFSLSTVLASLTHLDVNFFLGKVCFVAIGGGQVKHCMVDIATVK
KLADTHLSTLLFSEFDSEDDVTCTARRLLQMVQICAGLVPGISALYLGSFMNSTLQTDQF
NT seq 543 nt   +upstreamnt  +downstreamnt
atggcgacactcagaccgttcgataaaatgcctatgcttaacgccgctgcattactgtta
gtggggacagaagaaagtcatagagaacagctggcaagtgctatgttgaaagagccaaaa
acctttgaagtaaagattcacatggcacaatcactcccactgccttatgaaagggaacac
ttacgcccccggtttgatatggtggtctttctgatcaacctgcacagccagttcagcctc
tccactgttcttgcatctctcacacatttagatgttaacttctttcttgggaaagtgtgt
tttgttgccattggaggtggccaagtgaaacactgtatggttgatatagccacagtaaag
aagcttgctgacacacacctaagcaccctgcttttttctgagtttgatagcgaagatgat
gtgacctgtacagcgcggaggctgctgcagatggttcagatttgtgcaggattggttcct
ggtatctctgcgctgtatctagggtcatttatgaatagcactttacagacagaccagttt
tag

DBGET integrated database retrieval system