KEGG   Xenopus tropicalis (western clawed frog): 550005Help
Entry
550005            CDS       T01011                                 

Gene name
hist1h2bj, h2bfr
Definition
(RefSeq) histone cluster 1, H2bj
  KO
K11252  histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    550005 (hist1h2bj)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   550005 (hist1h2bj)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 550005
NCBI-ProteinID: NP_001017251
Xenbase: XB-GENE-5717971
UniProt: Q28J31
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVSKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacccgccaaatccgccccagcaccaaagaaaggctctaagaaagcggtgagt
aaaacgcagaagaaagatgggaagaagcgcaggaagagcaggaaggagagttacgccatc
tacgtgtacaaagtgctgaagcaggtgcaccctgataccggcatctcttccaaggccatg
agcatcatgaactcctttgttaacgatgtgtttgagcgcatcgcaggggaagcctcccgc
ctggctcattacaacaagcgctccaccatcacctcccgggagatccagaccgcggtccgc
ctgctgctgcctggggagctggccaagcacgctgtgtccgaggggacaaaggctgtgact
aaatacaccagcgccaagtaa

DBGET integrated database retrieval system