KEGG   Xenopus tropicalis (western clawed frog): 550032
Entry
550032            CDS       T01011                                 

Gene name
rbm5
Definition
(RefSeq) RNA-binding protein 5
  KO
K13094  RNA-binding protein 5/10
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    550032 (rbm5)
Spliceosome [BR:xtr03041]
 Complex A
  Other components
   Complex A specific factors
    550032 (rbm5)
SSDB
Motif
Pfam: G-patch OCRE RRM_1 G-patch_2 zf-RanBP GSIII_N zf-C2H2 zf-C2H2_4
Other DBs
NCBI-GeneID: 550032
NCBI-ProteinID: NP_001017278
Xenbase: XB-GENE-494987
UniProt: A4IGK4
Position
4
AA seq 831 aa
MGSDKRVSRSERSGRYGSAFDRDDRDDRDTRSRRRDSEYKRYRDERSSERYDDYRDYDSP
ERDRMRDRERRNSDRSEDGYHSDGDYMDHDYRQDYYMDEKESKTIMLRGLPININENDIR
ELVESFEGPQPADVRLMKRKTGLSRGFAFVEFYHLQDATRWMEANQKKLVIQGKTIAMHY
SNPRPKFEDWLSNKCGLYNFRRRLKCFRCGAAKAESDLEAPSGSSDAPQSTDYYSDTIIL
RNIGPHTVVDSILSALAPYVSLVVSNIRLIKDKQTQQNRGFAFVQLPSTLEASQLLQILQ
TLHPPLKIDGKTVGVDFAKSARKDLVLPDGHRVSAFSVASTAIAAAQWSSTQQAQQSGEG
GEYAYLQPGQEGYANYGQCSQDYQPFYQAQTGAAEQSTAPQAEGSAPVPATTSAVVCQSP
QMYQQPGSPTQSGTSTAANTTPASTTSTTEEAAPPNAVIPGVKYSVPDTSTYQYDESSGY
YYDPQTGLYYDPNSQYYYNSLTQQYLYWDGEKQTYLPAADGAGQSGAQPNGANAGSSKEG
KEKKEKPKSKTAQQIAKDMERWAKSLNKQKENFKNSFQPLSARDEERKESAAADAGFALF
EKKGALLERQFMPDMMMMVNTEEEEKPPNKALVAAYSGDSDNEEESERLLGVVDEEKLLD
WKKLACLLCRRQFPNKDALTRHQQLSDLHKQNLEVYRRSKMSEQELEALELKEREAKYRD
RAAERREKYGIPEPPEPKRKRFDPTVVNYEQPTKDGIDNSNIGNKMLQAMGWKEGSGLGR
KSQGITAPIQAQVRMRGAGLGAKGSSYGVNTSDSYKDAVRKAMFARFSEME
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgggatcagataaacgtgtgagtcgcagtgagcggagtggaagatatggttcagcattt
gatcgagatgatcgcgatgatagagacactaggagccgtcgcagagattctgaatacaaa
agatacagagatgaacgcagcagcgaacgctacgatgactacagagattatgacagtccc
gagcgtgatagaatgcgtgacagagagaggaggaacagtgatcgttcagaagatggttat
cattcagatggtgactatatggaccatgactaccggcaggactattacatggatgaaaaa
gagagcaagacgatcatgctaaggggcctccccattaatattaatgagaacgacattcgt
gaactagtggagtcttttgaaggaccgcagcctgctgatgtgcggctgatgaagagaaag
acaggtttaagccgcggtttcgccttcgtggagttttatcacttgcaagatgctacccgc
tggatggaagccaatcagaaaaagcttgtaatccagggaaagactattgccatgcattac
agcaatccccgacccaaatttgaggactggctatctaacaagtgtggcctgtacaacttt
cggcgaagacttaaatgcttccgctgtggggcagccaaggctgaatctgatttggaagcc
ccttcaggatcatctgatgctcctcagtctactgattactatagtgacaccataatcctt
cggaatattgggccccacactgtagtggattccatcttgtctgcgcttgccccctatgtc
tcacttgtggtcagcaacatccggcttatcaaagacaagcaaacacagcaaaacagaggc
tttgcatttgtgcagcttccttctactctggaggcatcacaactcctacaaattctgcag
accctgcatccacctctcaaaattgatgggaaaactgtaggtgtggattttgcaaaaagc
gctagaaaggatcttgtgttgccagatgggcacagagtcagtgcgttctctgtggcaagc
acagctattgctgctgcacagtggtcttcgactcagcaggctcagcaaagtggggaaggt
ggggaatatgcctacctgcagccaggacaggagggctatgctaattatggacagtgctcc
caagattaccaaccattttaccaagcacagactggagcagcagagcaaagcacagcacca
caagctgagggttctgctccagtgccagcaactacaagtgcagttgtgtgtcaaagtcct
caaatgtaccagcaacccggctctccgacccaatctggtacaagtacagctgccaacacg
actccagcatctactactagcacaacagaagaagcagcccctcctaatgctgttattcct
ggagttaaatactctgttccagatacttccacatatcaatatgacgaaagctcaggatat
tactatgatccccaaactggtctttactatgacccgaattctcagtattactacaactct
ctgactcagcagtacctatattgggatggtgaaaaacagacttacttgccagcagctgat
ggagcaggacaaagtggagctcagcccaatggtgcaaatgcaggctcgtctaaggagggc
aaagagaaaaaagaaaaaccaaaaagcaagaccgctcaacagattgcaaaggatatggag
cgatgggccaaaagtttaaacaaacagaaggaaaatttcaagaacagcttccagccactc
agtgcccgtgatgaagagagaaaagagtccgcagcagcagatgctggatttgctttgttt
gagaaaaagggagctttgttggagaggcagtttatgccagatatgatgatgatggttaac
actgaggaggaagaaaagcccccaaataaagcactggtagctgcttatagtggtgatagt
gacaatgaggaggagagtgagcgactacttggggtagtggatgaggaaaagttgctggat
tggaagaagctggcatgtctgttatgccgcagacaattcccaaacaaggatgccctgaca
agacatcagcaactgtcagacctgcataagcaaaacctggaagtctataggagatcaaag
atgtctgaacaagagcttgaagctttagaattaaaagaaagagaggcaaaatacagggac
cgtgcagcagaaaggagggaaaaatatggcattccagagccaccagaacccaaacgcaag
cgatttgaccctactgtggtgaattatgagcaacccacaaaagatggtatcgataatagc
aatattggaaataagatgctgcaggccatgggttggaaggagggttcagggctgggccga
aagagtcagggaattacagctcctattcaggctcaggtcagaatgaggggggccggtcta
ggagccaagggcagctcatatggagtaaacacatcagactcctacaaggatgcagtgagg
aaagcaatgtttgcgcgcttctcagaaatggaataa

DBGET integrated database retrieval system