KEGG   Xenopus tropicalis (western clawed frog): 550101Help
Entry
550101            CDS       T01011                                 

Gene name
mapkapk2, mapkapk3
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04218  Cellular senescence
xtr04370  VEGF signaling pathway
xtr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    550101 (mapkapk2)
   04370 VEGF signaling pathway
    550101 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    550101 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    550101 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    550101 (mapkapk2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     550101 (mapkapk2)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   550101 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like MAM1
Motif
Other DBs
NCBI-GeneID: 550101
NCBI-ProteinID: NP_001017347
Xenbase: XB-GENE-5896875
UniProt: Q28FG8
Position
2
AA seq 379 aa AA seqDB search
MMNPGIPFPNLPALNQTSIQQQQQQQQQQLKSTLQIKKNAITDDYKVTNQVLGLGINGKV
LEIFSKKSGEKFAMKMLQDCAKARREVELHWRASQCSHIVKIIDVYENLYQSRKCLLIIM
ECLDGGELFSRIQDRGDQAFTEREASEIMRSIGEAIQYLHSINIAHRDVKPENLLYTSKR
PNSVLKLTDFGFAKETTSHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLC
GYPPFYSNHGFAISPGMKKRIRMGQYEFPNPEWSEVSDEVKQLIRNLLKTEPTQRMTITE
FMNHPWITQSMQIPPTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDA
SNPLLQKRRKKITPHVATH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccctggcattccatttcccaaccttccagccctaaaccagacctcaatacaa
caacaacaacaacaacagcagcagcaacttaagtctactcttcaaataaaaaagaatgcc
ataactgatgactacaaagtcactaatcaggtcttgggactggggatcaacgggaaggtg
ctagagatcttcagtaagaagtctggagagaagttcgctatgaagatgttacaggactgt
gcaaaggcacgcagggaggtagaactgcactggcgggcttcccagtgttctcatatcgtg
aagattattgatgtgtacgaaaatctataccagtctagaaagtgtcttcttattattatg
gaatgtctggatggaggagaactcttcagcagaatccaggatagaggggaccaagctttc
acggaaagggaggcatctgagatcatgagaagcattggagaagcaatccagtacttacac
tctatcaatattgcccatagagatgtaaagccagaaaatctcctatatacatcgaaacgg
ccaaactcagtgttaaagctgactgattttggttttgctaaggaaaccacatcacacaat
tcactagcaacaccttgttacacaccttattatgttgctcctgaagttctcgggccagaa
aaatatgacaagtcgtgtgatatgtggtctctaggtgttatcatgtacattctactatgt
ggctatccaccattttactccaaccatggttttgccatttcccctggaatgaaaaaacga
atccgcatgggccagtatgaatttccaaacccagagtggtctgaagtttcagatgaagta
aaacagttgatcagaaatcttttgaagactgagccaactcagaggatgacgatcacagaa
tttatgaaccatccttggataacgcagtctatgcagattccaccaacacctcttcatact
agcagggtcttgaaagaagagaaggatttgtgggaagatgttaaggaagagatgacaagt
gcccttgccaccatgagagttgactatgagcagataaagataaagaagattgaagatgcc
tctaatcctctcctccagaagagacgaaagaaaattactccccatgtagcaactcactga

DBGET integrated database retrieval system