KEGG   Xenopus tropicalis (western clawed frog): 550111Help
Entry
550111            CDS       T01011                                 

Gene name
acvr1, actri, acvr1-a, acvr1-b, acvr1a, acvrlk2, alk-2, alk2, alk8, fop, sax, skr1, tsri
Definition
(RefSeq) activin A receptor type I
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04060  Cytokine-cytokine receptor interaction
xtr04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    550111 (acvr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    550111 (acvr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    550111 (acvr1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     550111 (acvr1)
Protein kinases [BR:xtr01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   550111 (acvr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS APH Haspin_kinase DUF3852 Ly49 HemY_N EVC2_like
Motif
Other DBs
NCBI-GeneID: 550111
NCBI-ProteinID: NP_001017357
Xenbase: XB-GENE-478850
UniProt: Q28E06
Position
9
AA seq 512 aa AA seqDB search
MVDGVMILPILMMVAFSSPSMEDEEMKLNAGQYKCVCEGMSCGSGDHCYGQQCFASLSNN
DGVLVSQKGCFQVYEQGKMTCKTPPSQDQAVECCQSDLCNMNITVKITDLTGRTKQGEAP
NYSVETLTIFILAPVIVLVVLSVLAVLIFRKIQQRHMQMLSNRDAEYGTIDGLIASNVGD
STLAEMLDHSCTSGSGSGLPFLVQRTVARQITLAECVGKGRYGEVWRGLWQGESVAVKIF
SSRDEKSWFRETELYNTVLLRHENILGFIASDMTSRNSSTQLWLITHYHELGSLYDYLQV
TTLDSVTCLRIVLSIASGLAHLHVEIFGTQGKPAISHRDLKSKNVLVKKNGQCCIADLGL
AVMHSQTTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIYAFGLVLWEVARR
MVSNGIVEEYKPPFYDVVPNDPSFEDMKKVVCVDQQRPNIPNRWFSDPTLTALAKLMKEC
WYQNPSARLTALRIKKTLTKIDNSLDKLKSDC
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtggatggtgttatgattcttcctatccttatgatggtggctttttcctctcccagc
atggaagacgaggagatgaagctgaacgcagggcagtataaatgcgtatgtgaagggatg
tcctgtggcagtggggaccactgttacgggcagcagtgtttcgcttcgctcagcaacaac
gatggcgtcctggtgtcccaaaagggctgcttccaagtctatgaacaaggcaaaatgacc
tgcaaaacccctccatctcaggaccaggccgtggagtgctgccagagtgacctctgtaac
atgaacatcactgtaaaaataacagatttaacagggagaacaaagcaaggggaggcacca
aattacagcgtggagacgctaacgatcttcatcttggcccctgtgattgtgctagtggta
ctttctgtcttggccgtgctgatcttccggaaaatccaacagcgtcacatgcagatgcta
agcaatcgagatgcagaatacggaaccattgacgggctcatcgcatccaatgttggagac
agtacgctggcagaaatgttggatcattcctgtacatcgggcagtggttctgggcttcca
ttcctggtacaaagaacagtcgctcggcagatcacactagcagagtgtgtgggaaaaggg
cgatacggcgaagtatggcggggtctctggcaaggagaaagcgtcgcagtgaagatcttt
tcatctcgagacgaaaaatcctggttcagggagacggagctgtacaacactgtgttactg
cggcacgagaatattctgggttttattgcctcagatatgacttccagaaactccagcacg
cagttgtggctaataactcactaccacgagctgggctctctctacgactacttgcaggtc
accacgctggattcggtcacctgtctgcgcatcgtgctgtccatagccagcggcctggcg
catctgcacgtggagatatttggcactcaggggaagccggccatttcccacagagacctg
aagagcaagaatgtccttgtgaaaaagaacggccagtgctgcattgcggatctagggctt
gccgtcatgcattcacaaacaaccaaccagctggatgttggcaataacccccgcgtggga
acgaagcgctacatggcccccgaagttctggacgagaccatccaagtggactgttttgac
tcctacaagcgagtggatatttatgcatttggtcttgtcctctgggaggtggccaggcga
atggtcagcaatggcatcgtagaagaatacaagcctcctttttatgatgttgtacccaat
gacccaagttttgaagacatgaagaaggttgtctgcgtggatcagcaaagaccaaacatt
cccaatagatggttctcagatccaactctcacagcgctcgctaagctgatgaaggaatgc
tggtatcagaacccctcggcaagactcacagccttacgcatcaaaaagactttaaccaaa
attgacaattctttagataaactgaaatctgactgttga

DBGET integrated database retrieval system