KEGG   Xenopus tropicalis (western clawed frog): 594900Help
Entry
594900            CDS       T01011                                 

Gene name
cbl, c-cbl, rnf55
Definition
(RefSeq) Cbl proto-oncogene, E3 ubiquitin protein ligase
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04012  ErbB signaling pathway
xtr04120  Ubiquitin mediated proteolysis
xtr04144  Endocytosis
xtr04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    594900 (cbl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    594900 (cbl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    594900 (cbl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    594900 (cbl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    594900 (cbl)
   04121 Ubiquitin system [BR:xtr04121]
    594900 (cbl)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     594900 (cbl)
Membrane trafficking [BR:xtr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    594900 (cbl)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    594900 (cbl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-RING_4 zf-rbx1 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 594900
NCBI-ProteinID: NP_001122110
Xenbase: XB-GENE-6258452
UniProt: B3DLI0
Position
7
AA seq 888 aa AA seqDB search
MATNLRKGGGLIGLVKDAFQPHHHHPTAQPGAVDRKTVEKCWKLMDKVVRLCQNQRLALK
NSPPYILDLLPDTYQHLRTIMSRYEGKMEILGENEYFRVFMENLLKKTKQTISLFKEGKE
RMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGQFQGDSFRITKADAAEFWRKAFGEKT
IVPWKIFRLALHDVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNW
NSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTGDGNILQTI
PHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTF
QLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRG
GGMAELLRHCMDGTPSPCYDDDDDDSGNDSIFVMKELAGAKVERPPSPLSATPQASLPPV
PPRLDLLPQRAPNQSGACSPATSSKASSSSHHKDKPLPVPPTLRDLPPPPPPDRPHSMPC
ESRPQRRPLPSTPAEKPLPLPTNRPGETWHPRAVPKAPASNLTPGDPWTGGRELTNRHSL
PFTLPSHIDERRDRHGSTQSLDNTGISATTELFGGLDNDDAKMKPSSSANAIYSLATRPF
PVSKPPTGDHVDSGDESEYMCPSSRPLIPAAVPKSEARRPLETLPGLRPPDQQTERESYE
TMYNIQCQATNPVVVEPSREEETNSAIANNGPENDDNEEDGYDIPKPHLPMAPARRTMSD
APNATPAFCSGAIGRDSGAGLLESSQVPERPPKPFPRRMNSERRSVVGGGSGDAPPAPLS
SEIESLLSQGYSQQDVNKALLIAHNNIEMARNILREFVSIPSPAHVAT
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaacctgcgaaagggcggcgggttgatcgggctggtgaaagatgctttccag
ccccaccatcaccatccgactgcgcagccgggggctgtggaccggaagacggtggagaaa
tgctggaaactcatggataaggttgttcggttgtgccagaatcaaaggctagctctgaag
aatagccctccttacattctagacctgcttcctgacacttatcaacaccttcggaccatt
atgtcccgatatgaggggaaaatggagattctgggagagaacgaatattttcgtgttttc
atggaaaacctcttgaagaagaccaaacaaacaattagcctctttaaagagggcaaagaa
cgcatgtacgaggaaaattctcagccaagaaggaacttgacaaaattatcactcatcttt
agtcacatgctggcagagctgaaagctatcttccctaatggacagttccaaggagattca
ttccgaatcacaaaggcagatgcagcagaattctggcggaaagcatttggagagaaaact
atagtcccctggaagattttccgtcttgcactgcatgatgttcacccaatctcctctgga
ctggaagccatggctttgaaatccacaattgacctcacatgcaatgattatatctctgta
tttgagtttgatatctttacccggctttttcagccatggtcctcccttctcaggaactgg
aatagtttggcagtaacacaccctggatacatggcctttctgacgtatgatgaggtcaaa
gctcggctgcagaaattcatccacaaacctgggagttacatttttcgtctgagctgcacg
cggctaggtcagtgggctattggatatgtcacaggcgatggaaatattttacagaccatc
ccacacaacaaaccactcttccaagcactgatcgatggcttccgggaaggattttacctc
ttccctgatgggcgcaaccaaaacccagatctgacaggcttgtgtgagcccactcctcag
gaccacatcaaagtcactcaggagcaatatgagctgtactgtgagatgggctccaccttc
cagctctgcaagatttgtgctgagaatgacaaggatgttaaaattgagccctgtgggcat
ctaatgtgcacatcatgcctcacctcctggcaggaatctgaggggcagggctgtcctttc
tgtcgctgtgaaatcaaaggaacggagcccatcgtcgtggatcccttcgacccaagaggt
ggtggtatggcagaattgctacggcactgtatggatggaaccccttctccttgctatgat
gatgatgatgacgatagtggaaatgactctatctttgtgatgaaagaattggcaggtgcc
aaggtggaaagacctccttcaccactgtctgccaccccacaagcctcacttccccctgtg
cctccccgtctagacctgttgccacagagagcacccaatcaatctggcgcttgcagtcca
gcaacaagttccaaggcttccagcagttcacaccacaaggataaacctttgcccgtgccc
ccaactctgcgagaccttccgcctccaccgcccccagacagacctcactctatgccatgt
gaaagcaggcctcagaggagacctcttccctctacccctgcagaaaagccccttccatta
cccactaatcgacctggagaaacctggcatccacgtgctgttccgaaagcacctgcctct
aatttgactcctggtgacccttggactgggggaagagagttgacaaatcgacattctctg
ccttttacactgccttcacacattgatgagaggagagaccgacatggaagcacacaaagc
ttggacaacacaggcataagtgccaccacagagttatttggaggactagataatgatgat
gccaaaatgaagccatcctcatctgcaaatgccatttactctttggccaccaggcctttc
ccggtgtcaaagcctccaacaggggatcatgttgacagtggagatgagtctgaatatatg
tgtccttcatcaaggcccttgattcctgcagcagtaccaaaatctgaagccaggagacca
ctagagacattacctggcttgcggccaccagatcagcagactgaaagggagtcctatgaa
accatgtacaatatccagtgccaagctaccaatccagttgttgtggagcccagcagggaa
gaagaaacaaattctgcaatagccaacaatggaccagagaacgatgacaatgaggaagat
ggatatgacataccgaaaccccatttgccgatggctcctgcccgtcgcaccatgtctgat
gctcctaatgccacacctgccttctgctctggtgccattggcagggactctggagcaggg
cttttggagtcttcccaggttcctgagcgtcccccaaaaccttttccaaggaggatgaac
tctgaacgcaggtcggtagttggaggaggttctggggatgcccctcctgcaccactatcc
agtgagattgagagcttgctgagtcaaggctactcccaacaggacgtgaacaaggccttg
ctcatagcccacaacaatattgaaatggcccgcaacatcctgcgtgaatttgtgtctatc
ccttcaccggctcatgttgccacatag

DBGET integrated database retrieval system