KEGG   Xenopus tropicalis (western clawed frog): 594952
Entry
594952            CDS       T01011                                 

Gene name
atp8b1
Definition
(RefSeq) phospholipid-transporting ATPase IC
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    594952 (atp8b1)
Enzymes [BR:xtr01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     594952 (atp8b1)
SSDB
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase E1-E2_ATPase Hydrolase Hydrolase_3 FimH_man-bind
Other DBs
NCBI-GeneID: 594952
NCBI-ProteinID: NP_001025562
Xenbase: XB-GENE-490143
UniProt: Q5BL50
Position
1
AA seq 1250 aa
MDTDYESTYEDDSQVPNDDVVPYSDDETDDELDSPQTDEPEQNRRNVQAEQSREPVIKEC
TWQVKANDRNFYDQPEFKKKVFLCLKKSKYAGNAIKTYKYNPITFLPVNLYEQFKRAANA
YFLVLLILQTIPQISTVTWSTTLIPLLLVLGITAIKDLVDDIARHKMDNEINNRPSEVIT
DGRFKKTKWKHIHVGDIIRINKNEFVPADVLLLSSSDPNSLCYVETAELDGETNLKFKMS
LEITDKLLQKEEQLAGFDGLVECEEPNNRLDKFVGTLFWRGNSFGLDADKILLRGCTVRN
TEYCHGLVLFAGADTKIMRNSGKTRLKRTKIDYLMNYMVYTIFVLLILAAAGLAIGQTFW
EAKLGAANVSWYLYDGNNYSPSYRGFLAFWGYIIVLNTMVPISLYVSVEVIRLGQSYFIN
WDLQMYFSPKDTPAKARTTTLNEQLGQIQYIFSDKTGTLTQNIMTFKKCTINGTTYGDDD
DELKSGQTKQVDFSWNPLADPSFTFHDNYLIEQIRAGKDKDVYEFFKLLALCHTVMAEKT
DGELIYQAASPDEGALVTAARNFGFVFLSRTQSTITISELGQEKTYEVLAILDFNSDRKR
MSIIVRQPDGRIRLYCKGADTVIYERLHPDNPIKDQTQKALDIFANASLRTLCLCYKDIN
KGDFENWSKKYKQASVATSNRDEALDRVYEAIETDLKLLGATAIEDKLQDDVSGTIFNLA
RADIKIWVLTGDKKETAENIGYSCKLLDDDTEILYGEDINVHLQTRMENQRNQMSGNQGA
QSNQSGAFLPTDKKHALIITGSWLNEILLEKKKRKKKRLKLKFPRTKEEKEQQLHEKLKA
YALKEQRQRSFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAVTLAIGDGANDVNMIK
TAHIGVGISGQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFSFT
LVHFWYSFFNGFSAQTVYEDWFITLYNVLYSSLPVLLVGLLDQDVSDKLSLAFPRLYVPG
QKDLLFNYKKFFLSLFHGIVTSLIIFFIPYGAFLLTMGQDGEAPSDYQSFAVTTATALVI
TVNFQIGLDTSYWTFVNAFSIFGSIAIYFGIMFDLHSAGIHVLFPSMFIFTGAAPNALRQ
PYLWLTIILTVAFCLLPIVALRFLAKTIWPSESDKIQKKGKKFKAEVEQRAKPKPFARGV
STRRSAYAFSHQRGYADLISSGRSIRKKRASLDAVFDNYPAQITHFTPQT
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggatacagattatgagtcgacctatgaggacgattcccaagtgccaaatgatgatgtg
gttccgtacagcgatgatgaaacagatgatgaactggacagcccccagactgatgagcct
gagcagaacaggagaaatgtacaggcagagcagagccgggaacctgtaattaaagaatgt
acctggcaagtaaaagcaaatgatcggaatttctatgaccagccagaattcaagaagaaa
gtgttcctgtgccttaagaaaagcaaatatgcaggaaatgcaatcaagacctacaaatac
aacccgatcaccttcctgccagttaatttatatgaacaattcaaaagagctgccaatgcc
tatttcttggtgttactcatccttcagaccattccccaaatatccactgtcacatggtca
accaccttgattcctctgctgctggtgctgggaataactgctatcaaagatctcgtggat
gacattgcccggcataaaatggacaacgaaataaacaaccgcccttctgaagttattaca
gatggaaggtttaaaaagacaaagtggaagcatattcatgttggagacatcatacgtatt
aacaaaaatgaatttgttcctgcagatgtactgttgctgtcgagctcagatcccaacagc
ttgtgctatgtagagactgcagagctggacggggagacaaacttgaaatttaaaatgtca
ctggaaataacagacaaacttctccaaaaagaagaacaattggcagggtttgatggtttg
gtagaatgcgaggaaccgaataatcgattggataaatttgttgggaccttgttctggaga
ggcaatagctttgggcttgatgctgataaaattctgcttcgagggtgcactgtccgaaat
acagagtactgccatggactggtcttatttgcaggcgctgataccaagattatgagaaac
agtgggaaaaccagattgaagagaacaaaaattgactatctcatgaattacatggtttac
acgatatttgttcttctaatcttggctgctgctggacttgccataggacaaacattttgg
gaagcaaagctaggtgccgctaatgtttcctggtatctctatgatgggaacaactatagt
ccctcatatcgaggatttcttgccttttggggttacatcattgtactgaacaccatggtg
cccatttctctttatgtaagtgttgaagtgattcgtttgggtcagagttactttatcaac
tgggacctgcagatgtacttctctcctaaggacacgccagccaaagccaggacgacaacc
ctgaatgagcagcttggtcagatccaatatatcttctccgataagactgggacattgaca
cagaacattatgacatttaaaaaatgcacaattaatggaaccacttatggagacgatgac
gatgaactcaagtctggccaaactaaacaggtggacttcagttggaatcctttggctgat
ccaagcttcacattccatgacaactatctgattgagcaaatacgggcaggaaaagacaaa
gacgtttatgagttcttcaagttacttgctctgtgccacactgtgatggctgagaagaca
gatggggaactgatctaccaggccgcatctccagatgagggtgctttggttacagcagcc
aggaactttggttttgtattcctgtctagaacccagagtacaatcactattagtgaactg
gggcaagagaagacttacgaggttctggccatcctggattttaatagtgaccgaaaacga
atgtctataatagtgcgtcagccagatggcagaatccgcctttactgcaaaggggcagat
actgtgatatatgaacgtctacatccagataatcctatcaaagatcagacacagaaggca
cttgacatttttgctaatgccagcctgaggaccctctgcctttgctacaaagacattaac
aaaggggactttgagaactggagcaagaaatacaaacaagccagtgtagctacaagcaat
cgtgatgaagcgctggatagagtatatgaagcgattgaaacagacttaaagctattggga
gctacggctattgaggacaagttgcaggatgatgtgagcggcacaatctttaacctggcc
cgcgctgatataaagatctgggttctgactggggataaaaaagaaactgcggagaacatt
ggatattcttgcaaactcttagatgatgacactgaaatcctctatggagaagatatcaat
gttcacttacaaacccgaatggaaaatcagagaaaccaaatgagtgggaatcaaggagct
caaagtaaccaatcgggggcctttttacctactgacaagaaacatgcactaattataaca
ggttcctggctgaatgaaattcttcttgaaaaaaagaaaaggaaaaagaaacgtctaaag
ctaaaatttcccaggaccaaagaggagaaagagcagcagctgcatgagaagctgaaggcc
tatgcactaaaagagcagagacagaggagctttgttgacctggcctgtgagtgcagcgcc
gttatctgctgtcgagtgacgcccaagcaaaaggccatggtagtcgatctggtgaaaaga
tacaagaaagcggttacgttggctattggagatggtgcaaatgatgttaacatgattaag
actgcccatattggcgttggtataagcggacaggaaggaatgcaagccgttatgtccagc
gactactcgttcgcccaattcagatacctccaaagacttctactggttcatggccgctgg
tcgtatatccgcatgtgcaaattcctacgctatttcttctacaagaatttctcgtttaca
ttggttcacttctggtactctttcttcaatggattttcagcccagacagtttatgaggat
tggttcataacactctacaacgttctgtactccagtcttcctgtgctcctggttggtctg
ttggatcaggatgtcagtgacaagctcagccttgcgtttccccgtctgtacgtccccgga
caaaaagatttgctattcaattacaagaagttttttttgagtctgtttcatgggattgtc
acatcgctcattatattcttcattccgtatggagccttcctgttaaccatgggacaagat
ggagaagcaccttctgattaccaatcgtttgcagtcacgactgccacggctctcgtcata
actgtcaatttccagattgggttagacacgtcgtactggacatttgtcaatgcgttttca
atctttggaagtatagccatttactttggcataatgttcgatctccacagtgccggaatc
catgttctctttccatcgatgttcatctttacaggtgctgctccaaatgctttgaggcaa
ccgtatctttggctcactataatccttacagttgccttctgcctactgccaatagtggca
ttacggttcttggcaaagacaatttggccttcagaaagtgataagattcaaaagaaaggc
aaaaaattcaaagctgaagtcgaacagagggcaaaacccaaaccctttgcacgtggtgtg
tctactcgccgctcagcttacgccttctcccaccagcgaggatacgccgacctcatttcc
tcaggacgcagcattcggaaaaagcgagcatccttggacgccgtgtttgacaactatcct
gcccaaatcactcacttcactccgcaaacttga

DBGET integrated database retrieval system