KEGG   Xenopus tropicalis (western clawed frog): 733555
Entry
733555            CDS       T01011                                 

Symbol
fbxo5
Name
(RefSeq) F-box only protein 5
  KO
K10292  F-box protein 5
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    733555 (fbxo5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xtr04121]
    733555 (fbxo5)
   03036 Chromosome and associated proteins [BR:xtr03036]
    733555 (fbxo5)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     733555 (fbxo5)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    733555 (fbxo5)
SSDB
Motif
Pfam: F-box F-box-like
Other DBs
NCBI-GeneID: 733555
NCBI-ProteinID: NP_001037934
Xenbase: XB-GENE-953946
UniProt: Q28GK6
Position
5
AA seq 391 aa
MMCGFTSNQSPKKLSSKKLSATNVHLEISPVKCDSPCKGYENVQASYLDTANCTTVTRGA
DIKDDLPLHNKENLLHRFGDLETHSDEEYSGLQDSGYSSILQNDSPCQDETDNNVSDIQL
RETPKNFVQFQKPLHTLSTKNLPALRFEEAMCSTLKKMRKTSKKIDWNAVDDVVCGGNYG
LENLIGKNMGLERFDILAELFHRDFKHLLTKILRHLSAMDLINVISVSTTWRKILQKDNS
AYNSYKLGCKELCEKKAKVSAHTATRDESLCRVPLASVQKVAASSLCTSKKQSKNRGLSN
NRHAEFIEVAQTLKNDQCLKVCVDCSSPAKYDPYLHRATCTRESCKFDFCTLCSCKYHGS
KCCQTSKPRSYRVPSEPLPGSKKSKQNLRRL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgatgtgcggattcaccagtaaccagtctccaaaaaagctctcttcaaaaaaattgagt
gccaccaatgttcacttagaaattagtccagtcaagtgtgacagtccatgcaaaggctat
gaaaatgtacaagcctcctatttggatactgcgaattgcacaacagttacaagaggtgca
gacatcaaagatgatctgcctttacacaacaaggagaatcttttgcatagatttggtgat
ttagaaacgcacagtgatgaagaatatagtggattgcaagacagtggctattcatcaata
ctgcaaaatgactcaccgtgtcaagatgaaacagataacaatgtgtcagatattcaacta
cgcgaaacgccaaagaattttgtgcagttccaaaaacctctccatactttatctacaaaa
aatttgccagcccttcgttttgaagaagctatgtgttctacgctgaagaaaatgagaaaa
acaagtaaaaaaattgactggaatgctgttgatgatgtagtttgtggtgggaactatggt
cttgagaatctgattggcaagaatatgggattggaaagatttgatatccttgcagaactt
tttcatcgagacttcaagcatttgctgactaaaattttaaggcaccttagtgcaatggat
ttgataaatgtcatcagcgtgagcacaacatggagaaaaatactacaaaaagataactcg
gcctacaattcttacaaattaggatgcaaggagctttgtgaaaagaaagccaaagtatct
gcccacactgcaacccgtgacgagtctctctgccgtgtgcctttggcgtctgttcaaaaa
gtagcagcttcgtctctctgcacatcaaaaaagcagagtaagaacagaggcctgtctaat
aacagacatgcagaatttattgaggttgctcagactttaaagaatgaccaatgccttaag
gtttgtgtagactgcagctctccagctaaatatgacccataccttcatcgtgccacctgc
acaagagaaagctgtaaatttgacttttgcacgctttgctcttgtaaatatcacggttca
aaatgctgccagacaagcaagccacggagttatcgagttccttcagagccattgcccggc
agcaaaaaaagcaaacagaacttacggaggttgtag

DBGET integrated database retrieval system