KEGG   Xenopus tropicalis (western clawed frog): 733842
Entry
733842            CDS       T01011                                 

Gene name
znf852
Definition
(RefSeq) zinc finger protein 852
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-Di19 Zn-ribbon_8 C1_1
Other DBs
NCBI-GeneID: 733842
NCBI-ProteinID: NP_001039058
Xenbase: XB-GENE-6460608
UniProt: Q28DU3
AA seq 373 aa
MDSFDLKDEITEVIVDPDMYDDASGSDVETDRDDEENGDDEENGDDEENGDDDSSHEEHQ
RSRSPPTHGRNLRKRQQFFCPECERCFKNNSELESHRKMHRGDYQYHCDICDQKFKYRSE
MLAHQKDHSSRSTEDVDYVVPPLSPQSSRNYDRSPEPKKNICLPVGEKPHKCNYCEKRFN
DKSILEAHQRIHVGKLTYPCTKCEESFSKASLLAAHFNTHKDGKPFECDQCDKKFNDHSL
LVAHKRTHTGEKPQKCNTCNKWFPNSASLAAHGECRSKPKPYQCRHCDKSFNDKALLITH
EGVHTDTKPFKCTQCSESFYLKTQLVAHQAVHAPEKPFPCSQCDKSFNKEETLMAHIRVH
NLQRMQVQTTLIP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggattcctttgaccttaaggatgaaatcactgaagtcatcgttgaccccgatatgtat
gacgatgcttcaggctccgatgtagaaacggaccgggacgacgaggagaatggggacgac
gaggagaatggggacgatgaggagaatggggacgacgacagctcccacgaggagcaccag
agaagccgctcccccccgacccacggcaggaacctgaggaaacgccagcagtttttttgc
cccgagtgcgagcgctgtttcaagaataactccgagctggagtctcaccgcaagatgcac
cggggggattaccagtaccactgcgacatatgcgaccagaagttcaagtacaggtcggaa
atgctggcgcaccagaaggatcattccagccggtcgacggaggacgtggattacgtggtg
ccgcccttgagcccgcagtcgagcaggaactacgacaggagccccgagcctaagaaaaac
atctgcttacctgtaggggagaagccgcacaagtgcaactactgcgagaagaggttcaac
gacaaatccatcctggaagcccaccagcggatccacgtagggaagctgacgtacccctgc
accaagtgtgaggagagcttctccaaggcctcgctgctcgccgcccacttcaacacccac
aaggacggcaagcccttcgagtgcgaccagtgcgacaagaagttcaacgaccactcgctc
ctcgtcgcccacaagaggacccacaccggcgagaagcctcagaagtgcaacacgtgcaac
aagtggttccccaactcggccagcctggcggcccacggggagtgccgctccaagcccaaa
ccctatcagtgccggcactgcgacaaaagcttcaacgacaaggcgctgctgatcacccac
gagggcgtgcacacagacactaagcccttcaagtgcactcagtgcagcgagagcttttac
ttgaagactcagctggtggcccatcaggccgttcacgccccggaaaagcccttcccttgc
agccaatgcgataagagcttcaacaaggaagagacactgatggctcacattcgcgtccat
aacctgcagcggatgcaggtacagaccacgttgattccgtga

DBGET integrated database retrieval system