KEGG   Xenopus tropicalis (tropical clawed frog): 733937
Entry
733937            CDS       T01011                                 
Symbol
dlg1
Name
(RefSeq) disks large homolog 1
  KO
K12076  disks large protein 1
Organism
xtr  Xenopus tropicalis (tropical clawed frog)
Pathway
xtr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    733937 (dlg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    733937 (dlg1)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    733937 (dlg1)
SSDB
Motif
Pfam: Guanylate_kin PDZ MAGUK_N_PEST L27_1 PDZ_assoc PDZ_6 PDZ_2 SH3_1 Peptidase_M50 SH3_2 DUF6288 SH3_9
Other DBs
NCBI-GeneID: 733937
NCBI-ProteinID: NP_001039116
Xenbase: XB-GENE-1016132
UniProt: Q28C55
Position
5:complement(106118864..106236996)
AA seq 927 aa
MPVRKQDTQRALTLLEEYRCKLHQTEDKQLRKSIERVIGIFQSNLFQALIDIQEFYEVTL
LDNPKSSDNAKPTEPVQTINTWEYSSLPNSTATCETLPSSLILNVEKYRYPDDDITSQEP
SSPHMLNDGRNVELVQISEKNISQKENIQGLVSHSLISPLKTPEADTPCPPIVPVIPVIP
VPAESNVIPSSTPQANPPPVIVNTDLETPAYVNGTDAEYEYEEITLERGTSGLGFSIAGG
TDNPHIGDDISIFITKIISGGAAAQDGRLRVNDCILRVNEVDVHDVTHSKAVEALKEAGS
IVRLYVRRRKPVTEKIMDIKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHK
DGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAKPTTMYMNDNYAPPDITN
SYSQQVDNHISPSGFIGHPLPPSPGRYSPAPKGMLEDDDLTREPRKVVLQRGTTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVVNASDDEWWQARQVTADGESEEIGVIPSKRRVEKKERARLKTVKF
NSKARGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEMETSDVDQHVTSNASDSESSYRGQE
EYVLSYEPVNQQEVNYSRPVIILGPTKDRVNDDLISEFPEKFGSCVPHTTRPKRDYEIDG
RDYHFVTSREQMEKDIQDHRFIEAGQYNSHLYGTSVQSVKEVAERGKHCILDVSGNAIKR
LQIAQLYPIAIFIKPKSVENIIEMSKRVTEEQGRKTYERAMKLEQEFTEHFTAIVQGDTL
EEIYNQIKQIIEEQSSTFIWVPAKEKL
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgcctgtcaggaagcaagatactcagcgtgcattgacccttctggaagaataccgctgc
aaacttcaccaaactgaagacaaacaactcaggaaatctattgagcgtgtaattggcatc
tttcagagcaatcttttccaagctcttatagatatacaggaattttatgaagtgacctta
ctggacaaccctaaatctagtgacaatgctaagccgactgaaccagtgcagactataaat
acatgggagtattccagccttcctaactcaacagcaacttgtgaaactctaccaagcagc
cttattttaaatgttgagaaatatcgatatcctgatgatgatatcacgtcacaagagccc
agttccccacacatgcttaatgatggaagaaatgtagaattagtccagatatctgaaaag
aacatctcacagaaagagaatatccaagggcttgtgtcacattcacttatttcccctcta
aagaccccagaagctgacactccctgtcctcccattgtccctgtgatccctgttattcca
gtccctgctgagagcaatgtcatcccatcctccactccacaggcaaatcccccaccggta
attgttaacactgacctggaaacgccagcttacgttaatggcacagatgctgaatatgaa
tacgaggaaattacactcgaaaggggcacttcaggacttggctttagcattgcaggtggc
acagataacccacacataggagatgatataagtatttttataacaaaaataatttctgga
ggagcagcagcacaagatggaagattacgggttaatgattgcatattacgggtgaatgaa
gtggacgtacatgatgtgacacacagcaaagccgttgaggcgttaaaagaggcaggatct
attgtccgtctgtacgtcagaaggagaaagcctgtaacagagaaaataatggacataaag
cttgttaaaggccccaaaggtcttgggttcagtatagctggcggtgtaggaaatcagcac
atacctggagataacagcatttacgtaactaaaatcattgaaggtggggcagctcacaaa
gatggaaggcttcaaattggggacaaacttctagcagtgaacaccgtgtgcctggaagaa
gtaagtcatgaagatgctgtgactgctttgaaaaatacatcagattttgttaatttgaaa
gtggcaaaaccaacaacaatgtacatgaacgacaactacgctcctccagatatcaccaac
tcatattctcagcaagtggataaccatatcagtccatcaggatttattgggcatccgctg
ccgccatcccctggccgatactccccagccccaaaaggaatgctggaagatgatgatttg
acacgggaaccaaggaaagttgttttacagcgaggtacaacaggacttggcttcaacatt
gttggtggtgaagatggagagggtattttcatatcctttatactcgctggaggtccggct
gatctgagtggagaactccagaaaggggatcgcattatgtctgtgaatggagttgaccta
aaatctgccactcatgagcaggcagcagcagccttgaagaatgctggccagacagtaacc
attgttgcgcaataccgtccagaagaatatagtcgttttgaggccaagattcatgactta
cgggagcagatgatgaatagcagcattagctctggatctggttccctgaggacaagccag
aagcgatcattatatgtcagggctctttttgattatgataagacaaaagacagtggcctc
ccaagccaaggacttaattttaaatttggagatatactgcacgttgttaatgcctctgat
gatgaatggtggcaagcacgccaagttacagcagatggagaaagcgaggaaattggagtc
attccaagcaagcgcagagttgaaaagaaagagcgtgccaggttaaagactgtcaaattt
aattcaaaagctagaggtgacaaagggcagtcattcaatgacaagcgtaaaaagaacctc
ttttcccgaaaatttccattctacaagaacaaggaccagagtgaaatggaaaccagtgat
gttgatcaacatgtaacttctaatgccagcgatagtgaaagtagttaccgtggtcaagaa
gaatatgtattatcatatgagccagtcaatcaacaagaagtaaactactcacgaccagta
ataattttggggcctacgaaagacagagtaaatgatgacctgatctcagaatttccagaa
aaatttggatcttgtgtaccacatacaacaagacctaaaagagactatgaaattgatggc
agagattaccattttgtgacttcccgagagcagatggaaaaggatatacaggatcacagg
ttcatcgaagctggacagtacaatagccacctctatggaacaagtgtccagtctgtgaaa
gaagtagcagaacggggcaaacactgcattcttgatgtatctggcaatgcaatcaaaaga
ttacaaatagcacaactctacccaattgcaatcttcatcaagcctaaatctgtggaaaac
attattgaaatgagcaaacgagtgacagaggaacaaggccgcaagacatacgagagagct
atgaaactagagcaggaattcacagagcattttacagcaattgtgcagggagacactttg
gaggaaatctacaaccagatcaaacagatcatagaagaacaatccagcaccttcatctgg
gttccagctaaggagaaattatga

DBGET integrated database retrieval system