KEGG   Xenopus tropicalis (western clawed frog): 734071Help
Entry
734071            CDS       T01011                                 

Definition
(RefSeq) microsomal glutathione S-transferase 3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    734071
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    734071
   00982 Drug metabolism - cytochrome P450
    734071
   00983 Drug metabolism - other enzymes
    734071
Enzymes [BR:xtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     734071
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   734071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 734071
NCBI-ProteinID: NP_001039212
Xenbase: XB-GENE-5796437
UniProt: Q28C18
Position
2
AA seq 141 aa AA seqDB search
MATTVHDVLPSNFAYVIFTYIYSVFMIMYLSMKVMGARKKYGVKYPEMYSKDQMFNCVQR
AHQNTMEVYPVWVIFQLIAGLAFPLAAAVLGAIWVTSRFSYAWGYYTGDPQKRMKAAYGY
IGYFGLMLLSIAAALQLLQII
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacggtccacgatgtgctcccaagtaatttcgcctatgtgatctttacttac
atctacagcgtgtttatgataatgtacctgagcatgaaggtgatgggggcaaggaagaag
tacggagtaaagtatcctgagatgtactccaaagaccaaatgtttaattgtgtccagaga
gcacatcagaacactatggaggtgtatccagtgtgggttattttccagcttatagctggg
cttgcatttccactcgctgctgcagttcttggagcaatttgggtgactagccgattttca
tatgcctggggatattacactggcgatccccagaagagaatgaaggcagcttatggctac
attgggtattttggattgatgctgctgtctatagccgctgctctacagcttctccaaatt
atttaa

DBGET integrated database retrieval system