KEGG   Xenopus tropicalis (western clawed frog): 734086
Entry
734086            CDS       T01011                                 

Gene name
pick1
Definition
(RefSeq) PRKCA-binding protein
  KO
K24062   
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: Arfaptin PDZ PDZ_6 PDZ_2 BAR_3 BAR GRASP55_65
Other DBs
NCBI-GeneID: 734086
NCBI-ProteinID: NP_001039225
Xenbase: XB-GENE-959376
UniProt: Q28BS9
Position
4
AA seq 421 aa
MTLKRTNWLSGPSFAFSKSQLKTMALRRNGGIPTVPGTVTLKKDSQNVIGISIGGGAQHC
PCLYIVQVFDNTPASLDGTIAAGDEITGVNGKSVKGKTKVEVAKMIQNVKGEVTIHYNKL
QADPKQGKSLDIVLKKVKHRLVENLSSGTADALGLSRAILCNDGLVKRLEELEKTGEFYR
GMMEHTKRLLRSFFELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIGL
LKTIKPMLSDLNTYLNKAIPDTKLTIRKYLDVKFEYLSYCLKVKEMDDEEYSSIALGEPL
YRVGTGNYEYRLILRCRQEARARFAKMRKDVLEKIELLDQKHVHDIVFQLQRFVSAMSKY
NDQCYEVLKEADIFPIEVDLAKTTLAYGQGDTFTDGIDEEEEEKAEKRNEEENGEKLIDD
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgactttgaagaggacaaactggctatctggaccaagctttgcattttctaaatcacaa
ctgaaaacaatggccctaagacggaatggtgggattccaacagtccctggaacagtaacc
ctcaaaaaggactctcagaatgtgattgggatcagcataggcggtggagctcagcactgc
ccctgcctttatatagtgcaggtatttgacaacaccccagcctccttggatggaaccatt
gctgcaggagatgaaataactggagtgaatggaaaatctgttaaaggcaaaaccaaagta
gaagtggcaaagatgattcagaatgtcaagggagaagtgactattcactacaacaagtta
caagctgaccccaagcagggaaagtctctggatattgtcctgaaaaaggtgaagcatcgg
ctagtggaaaacctgagctccggcacggcagatgcattgggtttgagtcgggccatcctg
tgtaatgatggtttagttaaaagactggaagaacttgaaaaaacaggggaattttatcga
ggtatgatggaacacaccaagcgcctcttaagatctttcttcgagctttcccagacacac
agagctttcggggatgtgttctcagtcatcggagtgcgggaaccacagccggctgcaagt
gaagcttttgtcaagtttgcagacgcacatcgcagcattgaaaaatttggaattggcctt
ctaaagaccataaaaccgatgctgagtgacttaaacacttaccttaataaagcaattcct
gacaccaagctcaccatccggaaataccttgatgtgaaatttgaatatctgtcatactgc
ttgaaggtgaaggaaatggatgatgaagaatacagtagcattgccttgggagaaccccta
tatcgtgttggtaccgggaactatgagtatcggctcattctgcggtgccgacaggaagca
cgcgcgcgctttgcaaagatgaggaaagatgtcctagagaagattgaactgcttgaccaa
aaacatgtgcacgatattgtgttccagctgcaacgatttgtttcagcaatgtccaaatac
aatgaccagtgctatgaagtactcaaggaggccgacatcttccctattgaggtggacttg
gctaaaacaactcttgcctatggtcagggagatacctttactgatggaatagatgaggag
gaagaggagaaggctgagaagagaaatgaagaagagaatggggagaaactgattgacgat
gcatag

DBGET integrated database retrieval system