KEGG   Xenopus tropicalis (western clawed frog): 779469
Entry
779469            CDS       T01011                                 

Gene name
ythdc2
Definition
(RefSeq) 3'-5' RNA helicase YTHDC2 isoform X2
  KO
K20099  ATP-dependent RNA helicase YTHDC2 [EC:3.6.4.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xtr03041]
    779469 (ythdc2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     779469 (ythdc2)
Spliceosome [BR:xtr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    779469 (ythdc2)
SSDB
Motif
Pfam: YTH HA2 Helicase_C R3H OB_NTP_bind DEAD AAA_19 Ank_2 ATPase AAA_22 AAA_7 PhoH Ank_5 SRP54 Ank_3 AAA_23 AAA_29 T2SSE ABC_tran AAA_30
Other DBs
NCBI-GeneID: 779469
NCBI-ProteinID: XP_002936459
Xenbase: XB-GENE-5881731
UniProt: F6TPR8
Position
1
AA seq 1419 aa
MSRPNSTSPRPNVVKKPSPANPGRSKGLKDIRIDEEVKIAVNIALEKFRYSDQKEMEFPS
SLTSTERAFIHRLAQSLGLVSKSKGKGPNRCLTLKKKNGSEASSSLMSCTLTQNTKKAVC
NLIQRFPLTNKERTELLPKTERGNVYAIEAENREIGKTSGCLNGGIPQVPDKRGESKYDF
FRQSLPVFEKQEDIIRIIKNNKVVLIVGETGSGKTTQIPQFILDNCQKNGLPCRIFCTQP
RRLAAISVAERVAAERGEIIGQCVGYQIRLESRVSPKTLLTFCTNGVLLRTLMGGDSTLS
AITHIIVDEVHERDRFSDFLLTKLRDAIQEHPTLKLILSSAALDVNLFIRYFGGCPVIYI
QGRPFEVKEMFLEDILRSTGYRNKGMLKYNKEKQCEEKQKTTLTEWYSAKQKNMKPETQR
QRSVPAIKEEYDILDDGGDTAFGQMTEKDANCLEPWLIKEIDACLSDIWLYRDKDAFAQL
FHLISTENVSVDYRHSETSATPLMVAAGQGFLSHVEQLISMGANIQSKASNGWMALDWAK
HFGQTEVVDLLESYSASLETEDLDENTLVQSDGNDLSIEDRELLKAYHHSFDDEKVDLDL
IMHVLFNICQITDTGAILIFLPGYDEIVGLRDRILLDDKRFADNAQRYHVFMLHSNMQTS
DQKKVLKLPPAGIRKIILSTNIAETSITVNDVVFVIDSGKVKEKSFDALNNVTMLKMVWI
SKASAIQRKGRAGRCRPGICFRLFSKLRFQNMLEFQTPELLRIPLHELCLHTKLLVPINC
PVADFLMKAPEPPPALIVRNAVQMLKTIDAMDNWEDLTEIGHHLADLPVEPHLGKMVLCA
VILKCLDPILTIACTLAYRDPFVLPSQASQKRAAMLCRKRFTAGTFSDHMALLRAFQAWQ
KAKSDGWERAFCEKNFLSQATMEIIIGLRTQLLGQLRASGFVRARGGGDIRDVNINSENW
AVVKAALLSGMYPNLIHVDRENMVLSGVKEKRVRFHPSSALSEPQYKKIPSANCQAEAVQ
ALPTDWLVYDEMTRSHRIANIKCCSVVTPVTAVLFAGPARLPSSALKEPSSFQVGDGIPN
DSSDSEMEDRNTFTLATLKLDEWLHFRLDPEAAGLLFQLRQKWQSLFLRRIQAPSKPWSQ
VDEATIRVIIAVLNTEEQSAGLQQPSGIGQRPRTLNCEDHLLTSGRINNSQKNFTEAESL
DDPSSLDRIAPPSAFSPQAKYKEKGNSLHKWPEDKSDLSSVKYKLSDNSSHPSPCESPSP
SSSAKGSNSPSPRQTIFVRYFIMKSSNLRNLEISQQKGIWSTTPSNERKLNQAFWESSTV
YLVFSVQGSGHFQGFARMTSEIGREKSQDWGSTSLGGVFKVEWIRKESLPFQQAHHLLNP
WNDNKKVQISRDGQELETLVGEQLLLLWDRVPLTSKSIP
NT seq 4260 nt   +upstreamnt  +downstreamnt
atgtcacgcccaaatagcacttcaccaaggcccaatgttgttaaaaagccaagtcctgct
aacccaggtcgctctaagggtcttaaagatatccgtatagatgaagaagtaaaaatagct
gtcaacattgcactggagaagtttcgttatagtgatcaaaaagaaatggaatttccttca
tcgttgacaagtactgagagagcatttattcatcgactggcacagtcactgggacttgtg
tctaaaagcaaagggaaaggtccaaatcggtgcctgacattgaaaaaaaagaatggatca
gaagcttcaagctcgctgatgtcctgcactctgacccaaaatacaaagaaagcagtatgt
aacctcatccagagatttcctctcacaaataaggaaaggacagagttgcttcccaaaaca
gagaggggaaatgtgtatgctattgaggctgagaatcgtgaaataggcaagaccagtgga
tgtttaaatggtggcattcctcaggtaccagataagagaggagaatcaaaatatgatttc
ttcaggcaatctttaccagtctttgaaaaacaagaggacatcattagaattattaagaac
aacaaagttgttttgattgtgggagaaaccggatcagggaagacaactcagatacctcag
tttattcttgataattgccaaaaaaatggattaccgtgtcgcatattttgcacccagcca
aggcgactggcagcaatatctgttgctgaaagagtcgcagcagagagaggggagataatt
ggccagtgtgttggttaccagatccgacttgaaagccgagtttcacccaagactctactt
accttttgtactaatggagttctacttcgcaccctgatgggaggagacagcactctatct
gctataactcacattatcgtggatgaagttcatgaacgtgatcgatttagtgacttcctg
ctgaccaaacttagagacgcaatacaggagcaccctactttgaagctgatcctttcaagt
gcagccttggatgttaacttgttcataagatattttggaggttgccctgttatatatata
caaggaagaccttttgaagtaaaagagatgtttttagaagatatactgaggagtactggg
tacagaaataagggaatgcttaaatataacaaagaaaaacagtgcgaggagaagcaaaag
acaacattaactgaatggtattctgcaaaacaaaagaacatgaagccagaaactcaacgg
cagaggagtgtcccagcaattaaagaagaatatgacatattagatgatgggggtgacact
gcctttggtcagatgactgaaaaagatgccaactgtcttgagccgtggttgataaaggaa
attgatgcttgtctctctgatatttggctctatcgagataaggacgcttttgctcagctc
ttccatttgatatcaacagaaaatgtcagtgttgactacagacacagtgaaactagtgct
accccattaatggtagcagccggacaagggtttttaagtcatgtagagcagctaattagc
atgggggccaatatccagagcaaagcatcaaatggatggatggctttggattgggctaaa
cactttggccagactgaggttgtggacctgttggagtcgtacagtgcttctttggagact
gaggatctggatgagaataccctggttcaatctgatggcaatgatttgagcattgaggac
agagaactcttaaaagcttaccatcacagttttgatgatgaaaaagtagatcttgatctt
attatgcacgttctttttaacatctgtcaaataaccgatacaggggctatactaatcttt
cttcctggctatgatgaaatagtagggctgagagatcgaatcttgctcgatgacaaaaga
tttgctgataatgctcaaaggtaccacgtatttatgttgcattcaaacatgcagacatca
gaccagaagaaagtgctaaagcttccaccagctggcatcagaaaaattatactttctact
aatattgccgaaaccagcatcacagttaatgatgttgtttttgtgattgactctggtaaa
gttaaagagaaatcctttgatgctctgaacaacgtaaccatgcttaaaatggtgtggatt
tccaaagccagtgcaattcaaaggaaaggaagggctggtcgctgtaggcctggaatctgt
ttccgtttatttagcaagcttcgttttcaaaatatgttggaatttcagactcctgaacta
ctgaggatacctctgcatgagctctgcctacacaccaaattgctagtgccaattaactgt
cctgttgcagattttctaatgaaagctccagagccgccaccagctctaatagtccgtaat
gctgtacagatgctgaagactatagatgccatggataattgggaagatctgacagaaatt
ggtcatcatttggcagacctgccagtagagccccaccttgggaaaatggtgctttgtgca
gtaattttaaagtgcctagatccaattttgaccatagcctgtactttggcctaccgggat
ccttttgtcttacctagccaagcctctcagaaacgtgctgccatgctgtgcagaaagaga
tttacagcaggaacatttagtgatcatatggctctacttagagctttccaggcatggcag
aaagcaaaaagtgatggatgggaaagggcattttgtgagaagaattttctttctcaggcc
acaatggaaattatcatcggactgaggacacagctcctgggtcagcttagagcttcaggt
tttgtaagggctcgtggaggaggagatatacgggacgttaatataaactctgaaaattgg
gctgtggtgaaggctgccctgttgtctggcatgtatccaaacttaatacatgtggacaga
gaaaatatggtactaagtggtgtaaaggaaaagcgtgtgaggttccaccctagctctgca
ttaagtgagccacagtacaaaaagatcccttctgcaaattgtcaggcggaagctgttcaa
gcattgcctacagactggcttgtgtatgatgagatgacccgttcccatagaattgcaaat
attaagtgctgttcagtggttactccagtgactgcagtgttatttgcaggacctgcaaga
cttcccagcagtgctttgaaggagccgtcttctttccaagttggcgatggtataccaaat
gacagtagtgacagtgaaatggaggacaggaacacgttcactctagcaacacttaaactg
gatgaatggctgcatttcagattggaccctgaggctgctggacttttatttcaacttcgg
cagaaatggcagagcttatttcttaggcgaattcaagcaccgtcaaaaccttggtctcaa
gttgatgaagccaccattagagtaattatagctgttctaaacacagaagagcaatcagct
ggtttgcagcaaccttccgggattggacaaagaccaaggacattgaattgtgaagaccat
ctgttaacttctgggaggattaataatagtcagaagaatttcacagaggcagagtcacta
gatgatccatccagtttagacagaattgctccaccgtcagccttcagtccacaggcaaaa
tataaagagaaggggaattcgctgcataaatggcctgaagacaaatctgatctgtcatca
gtgaaatacaaattatcggataacagtagccatcccagtccctgtgaaagtccttcccct
tcatcctctgcaaagggctcaaactcaccatcccccagacaaacaatatttgtgcgatac
ttcatcatgaagagcagcaaccttagaaatcttgaaatttcacagcagaagggaatatgg
tccacaacaccgagcaatgagcgcaaattaaaccaagccttttgggagagcagcacagtt
tacttggtgttctctgttcaaggttcgggccactttcagggctttgcaagaatgacttca
gagattgggcgagagaaaagtcaggactggggctccacaagccttgggggtgtgtttaaa
gtggaatggataagaaaagaaagcctaccttttcagcaggctcatcacttgcttaaccca
tggaatgataataaaaaagttcaaatcagccgtgacgggcaggaacttgagacacttgtt
ggagaacagttgcttctgttgtgggacagagttcctttgacaagcaaaagtattccttag

DBGET integrated database retrieval system