KEGG   Xenopus tropicalis (western clawed frog): 779505Help
Entry
779505            CDS       T01011                                 

Gene name
mtbp, mdm2bp
Definition
(RefSeq) MDM2 binding protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: MTBP_mid MTBP_C MTBP_N FhuF
Motif
Other DBs
NCBI-GeneID: 779505
NCBI-ProteinID: NP_001107690
Xenbase: XB-GENE-990920
UniProt: Q0P4G8
Position
6
AA seq 867 aa AA seqDB search
MERFVLCIHWERRAESGAEQHRVPQGLAYAQDIYTQLKEYSTKYTSTFPACSLTGNPGTR
KWFFALQSLYGSFQFCSSDWDDLCPAVTTEDNEEPVQTALDECLEALQFPDGEDDNSRDS
ISQTNLFEEAAELLHQLSDKLPAPGRALVDVLLFTPEAPKLKDCLSAIGAIKHLKEWHSA
KITIVSKDCKGWQKIAKFLSANVVESACPKELIDSHELWRGNIEISERKFTSEVEFPEFC
LRSVSDDKFPYFEHNGDDKNKAVLLPEVFHYYGTSLEYVQMVALSEIPSYFVSDSVFELS
ITRNALQGKSKLMLDQLCSLTDKVGAIFMLSCNVCSLPNPPALQRSSKKWREYMSRKPKD
IKVPGVELKGEYCSYYFLIQGKGSGFCKATLLHSASQISGAASLVLLHQRLNNYQPGNMA
EGTSEILDSVPHFRGEQIAVRERILARAQALAVNEYLKRHEALPHPSVSHVNNLRTLLAV
TRERVIGDCESRLDGVSYKNLQNITVSTPTVSESEAMISNPADWPERNVLQNLENFEKVK
QRLRASILSSSAEQLLGRKDGLKEGMTLLDAKELLKYFTPQGIAVGELQPLQVQRGDNAF
LLTPKLTPKKLKGLPFEKAAECHYHGLEYCLDNRKALDRDVAFSELQSRLIRYETQTTCT
RECCPVPFALSPLPSPAVLSEPGSVPDGESIQTELRGEPLLLKRRSRDLDGLYASKRLAK
SGSSDSLVSLASEGSGHQPPTRATRLRPERAASSTSAVQPPSARVQMAPSVPAQSKQSTH
PDLEQKESRSQKHNRMLKEVVSKTLQKYGIGVEHPCYAACNQRLFDISKFFLKDLKTSRG
LLDEMKKAASNNAKQVIQWELDKLKKK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctttgtgctgtgcattcactgggagaggagggcggagagtggcgctgagcag
caccgagtcccccaaggtttggcctatgctcaggatatatacacccagctgaaggaatac
tccacaaaatatacaagcacttttccagcctgctcactgaccggtaacccaggaacaagg
aagtggttctttgcgcttcagtcactttatggttcttttcagttctgcagttcagattgg
gatgacctctgtccagcagttacaacagaagataatgaagagcctgttcagactgcacta
gatgaatgcttagaagcactgcagttcccagatggggaagatgacaacagcagagactcc
atttctcaaacgaatttatttgaagaagctgcagaattacttcaccagttgtcagacaaa
cttcctgcacctggtcgagctttggtggatgttctgctgttcactccagaggctccaaag
ttaaaagactgtttgtctgcaattggggccataaagcacctgaaagaatggcattcagcc
aagataaccattgtttcaaaggattgcaaaggatggcagaagatagcgaagtttctctca
gcaaatgttgtggaatcagcctgtcctaaggaattaattgactcgcatgaattatggagg
ggaaacatagagatcagtgagagaaagtttacatctgaagttgaatttccagaattttgt
ttacgatctgtctctgatgacaagtttccttattttgaacataatggcgatgacaaaaac
aaggctgtgttattaccagaggtttttcattactacggtacatcgctggagtatgtccag
atggtggcgctttcagagatcccttcttactttgtatcggattctgtgtttgaactaagt
ataacaaggaatgctctgcaaggaaaatctaagctgatgttggaccagctgtgctccctg
actgacaaggtaggggctatattcatgttatcatgcaatgtctgcagcctgccaaatcca
ccggcacttcaacgcagctcaaagaaatggagagagtatatgtctaggaaacctaaagac
attaaagttccaggagtagagttaaaaggagagtattgcagttactacttcttaattcaa
ggcaaaggctccggattctgtaaggcaacattgttacattccgccagccagatcagcggg
gcagcttccttggtcttgttgcatcagaggttgaataattaccaaccaggcaatatggca
gaaggaacttcagagattttagattctgttccccattttcgcggagagcagattgctgtg
agagagcgaatactagctcgggctcaggcactagctgtgaatgagtatctaaaaagacat
gaagccctgccgcatccgtcagtgtctcatgttaacaatctcaggacactgttagcagtt
acaagggaacgtgtcattggagactgtgagagcaggttagatggtgtatcctacaaaaat
ctgcagaatatcactgtttctacaccaactgtttcagaatcggaagcaatgatatctaac
cctgcagactggcctgaaagaaatgttcttcagaatttggaaaattttgaaaaagtaaaa
cagaggttaagggcatccatactttccagttcagcagaacagctgcttgggcgtaaggat
ggactgaaggaaggaatgactttgctcgatgctaaagaactattgaaatattttactcca
caaggtattgctgttggggagctgcagcctttacaagttcaacgcggtgacaatgcattc
cttctaactccaaaacttaccccaaagaaattaaaaggtttaccctttgaaaaagctgct
gagtgccattatcacggtctagaatattgcctcgacaacagaaaggcccttgatcgagat
gtggcgttttccgaactacagtcccgccttattcgctatgaaacccagacgacttgcaca
agggagtgctgccctgttccatttgctttaagcccccttccttcccctgctgtcctctcg
gagccaggcagtgtgcctgatggagaatccatacaaactgagcttaggggagagccatta
ctgctgaaacggcgctcaagggacttagatggactgtatgccagcaagagacttgcaaaa
tcaggaagttctgattctttggtgtcacttgcaagcgaaggtagtgggcatcagccgccg
actagagccacaagactgcggccggaaagagcagcttcatccacttcagcggttcagcca
cctagcgcaagggtccaaatggcaccaagtgtaccagctcaatcaaagcaaagcactcat
cccgacctggaacagaaggagtctagatcccaaaaacacaatcggatgctgaaagaagtg
gtttcaaaaacccttcagaaatatggcattggcgtggaacatccatgttatgcagcctgc
aaccagagattgtttgatatatcaaagttctttttaaaggatctgaaaacatcaagaggt
ctgttagatgaaatgaagaaagctgcaagtaacaacgccaaacaggtgattcagtgggaa
ctggacaagctaaagaagaaataa

DBGET integrated database retrieval system