KEGG   Xenopus tropicalis (western clawed frog): 779515Help
Entry
779515            CDS       T01011                                 

Gene name
mapk10, jnk3, jnk3a, p493f12, p54bsapk, prkm10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04137  Mitophagy - animal
xtr04140  Autophagy - animal
xtr04141  Protein processing in endoplasmic reticulum
xtr04210  Apoptosis
xtr04217  Necroptosis
xtr04310  Wnt signaling pathway
xtr04510  Focal adhesion
xtr04530  Tight junction
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04910  Insulin signaling pathway
xtr04912  GnRH signaling pathway
xtr04914  Progesterone-mediated oocyte maturation
xtr04920  Adipocytokine signaling pathway
xtr04933  AGE-RAGE signaling pathway in diabetic complications
xtr05132  Salmonella infection
xtr05168  Herpes simplex infection
Module
xtr_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    779515 (mapk10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    779515 (mapk10)
   04012 ErbB signaling pathway
    779515 (mapk10)
   04310 Wnt signaling pathway
    779515 (mapk10)
   04068 FoxO signaling pathway
    779515 (mapk10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    779515 (mapk10)
   04137 Mitophagy - animal
    779515 (mapk10)
  Cell growth and death
   04210 Apoptosis
    779515 (mapk10)
   04217 Necroptosis
    779515 (mapk10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    779515 (mapk10)
   04530 Tight junction
    779515 (mapk10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    779515 (mapk10)
   04621 NOD-like receptor signaling pathway
    779515 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    779515 (mapk10)
   04625 C-type lectin receptor signaling pathway
    779515 (mapk10)
  Endocrine system
   04910 Insulin signaling pathway
    779515 (mapk10)
   04920 Adipocytokine signaling pathway
    779515 (mapk10)
   04912 GnRH signaling pathway
    779515 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    779515 (mapk10)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    779515 (mapk10)
  Infectious diseases
   05132 Salmonella infection
    779515 (mapk10)
   05168 Herpes simplex infection
    779515 (mapk10)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     779515 (mapk10)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   779515 (mapk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 779515
NCBI-ProteinID: NP_001107691
Xenbase: XB-GENE-1009840
UniProt: A7MC39
Position
1
AA seq 441 aa AA seqDB search
MSRHFLYNCSEPTLDVKIAFCQGFGNQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDEALQHPYIN
VWYDPSEVEAGPLRDIWNEQPVKTKNNEKPPPQIYDKQLDEREHTIEEWKELIYKEVMNF
EEKTKNGVVKGQPSPSAQVQQ
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcatttcttgtataactgcagtgaacctactctggatgtgaagattgccttt
tgtcagggattcggtaatcaagtggatgtgtcgtatattgctaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtaggagactcgacattcactgtt
cttaaacgctaccagaatctaaaacctataggctctggagctcagggaatagtttgtgct
gcctatgatgctgtccttgatagaaatgtggcaattaagaaactaagtagaccatttcag
aatcaaacacatgccaaacgggcatatagagagttggtccttatgaagtgtgtaaatcat
aaaaatattatcagtttattaaatgtcttcacaccccagaaatctcttgaggagttccag
gatgtatacctagttatggaactgatggatgctaacttgtgccaagtgattcagatggaa
ctagatcatgaacgaatgtcttatttgctctaccaaatgctatgtggaataaagcacctt
cattcagctggaattatacatagggatctaaagccaagtaatattgttgtgaagtcggat
tgcacattgaagatccttgactttggattggcaaggacagctggtactagtttcatgatg
actccttatgtagttacccgttactacagagctccagaagttatacttgggatgggatac
aaagagaatgtggatatttggtctgtgggatgcattatgggagaaatggtccgccacaag
atcctctttccaggaagggactatattgaccagtggaacaaagtaatagaacagctggga
actccgtgcccagagtttatgaaaaagctacaaccaacagtacgaaactatgtggaaaat
cgacctaaatatgctggtctcacttttccgaagctatttcccgattccctctttccagca
gattcagagcataataaactcaaagccagtcaagcaagagatcttttatcaaagatgctt
gtcattgatccagccaagagaatatcagttgatgaagcgctacagcatccgtatatcaat
gtctggtatgacccttcagaagttgaggcgggccctctgagggatatatggaatgaacag
ccagtcaaaacaaagaataatgaaaagcctccccctcaaatctatgacaaacaactggat
gaaagagaacataccattgaagaatggaaagaactaatctataaggaagtgatgaacttt
gaagaaaaaactaaaaatggtgttgtaaaaggacagccctctccttcagcacaggtgcag
cagtga

DBGET integrated database retrieval system