KEGG   Xenopus tropicalis (western clawed frog): 779708
Entry
779708            CDS       T01011                                 

Symbol
glrb
Name
(RefSeq) glycine receptor subunit beta precursor
  KO
K05196  glycine receptor beta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    779708 (glrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    779708 (glrb)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    779708 (glrb)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    779708 (glrb)
Ion channels [BR:xtr04040]
 Ligand-gated channels
  Glycine
   779708 (glrb)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Hepatitis_core
Other DBs
NCBI-GeneID: 779708
NCBI-ProteinID: NP_001072255
Xenbase: XB-GENE-1011734
UniProt: Q0VA59
Position
1:complement(53455695..53522002)
AA seq 497 aa
MKFLLGILLFLVFSLWFDGVHSKEKSSKKGKGKKKQYLCPSQLSAEDLARVPANSTSNIL
NRLLVSYDPRVRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQRWNDPRLKLPN
DFRGSDALTVDPTMFKCLWKPDLFFANEKNANFHDVTQENILLFIFRDGDVLLSMRLSIT
LSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQMEKIALPQFDIKTEDIEY
GNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVP
LGIFSVLSLASECTTLAQELPKVSYVKAIDVWLIACLLFGFASLVEYAVVQVLLNSPKRI
EAEKAKIAKAEQAEGKGANAAKKNTVNGTGTPIHISTLQVGENRCKKVCTSKSDLRSNDF
SIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPSEAKRIDLYSRAL
FPFCFLFFNVIYWLVYL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaagtttctactggggattcttctgtttctcgttttttctctttggtttgatggcgtc
cactctaaagaaaaatcatcaaaaaaagggaagggcaaaaagaaacagtatctatgtcca
tcccaactatctgctgaagatcttgccagagtccctgctaactccactagcaacatactg
aacagacttttggtcagttatgatccaagggtacgaccaaacttcaaaggcattcctgtg
gatgttgtagtcaacatttttataaacagttttggatctatacaagaaacaacaatggat
tacagagtcaacatttttctaaggcaaagatggaatgaccctcgccttaaactccccaat
gacttccgaggctctgacgctctgacagttgatcccacaatgtttaaatgtctctggaag
ccagatttattttttgcaaacgaaaagaatgcaaactttcacgatgtcacccaagaaaat
attttactgttcattttccgcgatggagatgttcttctaagtatgaggttatccatcaca
ttgtcatgccctttggacttaacattattcccaatggatactcaacgctgtaaaatgcag
ctggaaagttttggctataccaccgatgatttgcggttcatttggcagtcaggagatcct
gttcaaatggaaaaaattgccttacctcagtttgatattaaaacagaagacatagagtat
ggcaattgtacaaagtattacaaaggcactggatattatacttgtgtggaagtgatcttc
accctaaggcgacaggttggattttacatgatgggtgtttatgccccaactttactcatc
gttgtcctttcctggctctcattttggatcaacccagatgcaagtgctgcaagagtgcca
cttgggatcttttccgttctcagcttggcatctgaatgtaccaccttagcacaggagctg
ccaaaagtgtcatatgtaaaggctatagatgtttggcttattgcctgtctcctgtttggt
tttgcctcccttgttgagtatgctgttgttcaggtattgttgaacagcccaaaaaggatt
gaagcagagaaagctaaaattgcaaaggctgagcaggccgaaggaaagggagccaatgca
gccaaaaagaatacagtcaatggaaccggtactcctatccatatcagcaccttgcaagtc
ggagagaatcgatgcaaaaaagtctgtacgtctaaatcagatttgagatccaacgacttc
agcattgttgggagcctgcccagagattttgaattgtccaattatgactgttatgggaaa
ccaattgaagtcaacaatggactgggaaaatcccaagcgaagaacaacaaaaagcctcca
cctgccaagccagtcattccatcagaagcgaagcgaattgatctttactccagggcatta
tttccattctgctttttgttctttaatgttatatattggctggtatatttatga

DBGET integrated database retrieval system