KEGG   Xenopus tropicalis (western clawed frog): 779708
Entry
779708            CDS       T01011                                 

Gene name
glrb
Definition
(RefSeq) glycine receptor subunit beta precursor
  KO
K05196  glycine receptor beta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    779708 (glrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    779708 (glrb)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    779708 (glrb)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    779708 (glrb)
Ion channels [BR:xtr04040]
 Ligand-gated channels
  Glycine
   779708 (glrb)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Hepatitis_core
Other DBs
NCBI-GeneID: 779708
NCBI-ProteinID: NP_001072255
Xenbase: XB-GENE-1011734
UniProt: Q0VA59
Position
1
AA seq 497 aa
MKFLLGILLFLVFSLWFDGVHSKEKSSKKGKGKKKQYLCPSQLSAEDLARVPANSTSNIL
NRLLVSYDPRVRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQRWNDPRLKLPN
DFRGSDALTVDPTMFKCLWKPDLFFANEKNANFHDVTQENILLFIFRDGDVLLSMRLSIT
LSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQMEKIALPQFDIKTEDIEY
GNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVP
LGIFSVLSLASECTTLAQELPKVSYVKAIDVWLIACLLFGFASLVEYAVVQVLLNSPKRI
EAEKAKIAKAEQAEGKGANAAKKNTVNGTGTPIHISTLQVGENRCKKVCTSKSDLRSNDF
SIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPSEAKRIDLYSRAL
FPFCFLFFNVIYWLVYL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaagtttctactggggattcttctgtttctcgttttttctctttggtttgatggcgtc
cactctaaagaaaaatcatcaaaaaaagggaagggcaaaaagaaacagtatctatgtcca
tcccaactatctgctgaagatcttgccagagtccctgctaactccactagcaacatactg
aacagacttttggtcagttatgatccaagggtacgaccaaacttcaaaggcattcctgtg
gatgttgtagtcaacatttttataaacagttttggatctatacaagaaacaacaatggat
tacagagtcaacatttttctaaggcaaagatggaatgaccctcgccttaaactccccaat
gacttccgaggctctgacgctctgacagttgatcccacaatgtttaaatgtctctggaag
ccagatttattttttgcaaacgaaaagaatgcaaactttcacgatgtcacccaagaaaat
attttactgttcattttccgcgatggagatgttcttctaagtatgaggttatccatcaca
ttgtcatgccctttggacttaacattattcccaatggatactcaacgctgtaaaatgcag
ctggaaagttttggctataccaccgatgatttgcggttcatttggcagtcaggagatcct
gttcaaatggaaaaaattgccttacctcagtttgatattaaaacagaagacatagagtat
ggcaattgtacaaagtattacaaaggcactggatattatacttgtgtggaagtgatcttc
accctaaggcgacaggttggattttacatgatgggtgtttatgccccaactttactcatc
gttgtcctttcctggctctcattttggatcaacccagatgcaagtgctgcaagagtgcca
cttgggatcttttccgttctcagcttggcatctgaatgtaccaccttagcacaggagctg
ccaaaagtgtcatatgtaaaggctatagatgtttggcttattgcctgtctcctgtttggt
tttgcctcccttgttgagtatgctgttgttcaggtattgttgaacagcccaaaaaggatt
gaagcagagaaagctaaaattgcaaaggctgagcaggccgaaggaaagggagccaatgca
gccaaaaagaatacagtcaatggaaccggtactcctatccatatcagcaccttgcaagtc
ggagagaatcgatgcaaaaaagtctgtacgtctaaatcagatttgagatccaacgacttc
agcattgttgggagcctgcccagagattttgaattgtccaattatgactgttatgggaaa
ccaattgaagtcaacaatggactgggaaaatcccaagcgaagaacaacaaaaagcctcca
cctgccaagccagtcattccatcagaagcgaagcgaattgatctttactccagggcatta
tttccattctgctttttgttctttaatgttatatattggctggtatatttatga

DBGET integrated database retrieval system