KEGG   Xenopus tropicalis (western clawed frog): 779723Help
Entry
779723            CDS       T01011                                 

Gene name
galc, GALCERase
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00600  Sphingolipid metabolism
xtr01100  Metabolic pathways
xtr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    779723 (galc)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    779723 (galc)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     779723 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 779723
NCBI-ProteinID: NP_001072270
Xenbase: XB-GENE-1000107
UniProt: Q0VA39
Position
8
AA seq 678 aa AA seqDB search
MRTVLAGSRRAPGCGEGMFILWLVLLLFPGAPAQYSVDDLGGLGRMFDGIGAISGGGATS
RLLVNYPEPQRTEILDYLFKPNFGASLHIFKVEIGGDAQTTDGTEPSHMHYPDDQNYFRG
YEWWLMKEAKKRNPAIKLIGLPWAFPGWIGNGKNWPYDFPDVTAYYVVSWIIGAKQYHNL
DIDYIGIWNERAYDIKYIKLLRYTLDKNNLEHVKIIASDNLWQPIAFHMLQDPELLRVVD
VIGAHYPGTHAAQDAILTGKTLWASEDYSTYNDEVGGGCWARILNQNYVNGNMTSTISWN
MVASYYEQLPFGLEGLMTAKEPWSGNYVVSTPIWITAHTTQFTQPGWYYLKTVGHLDKGG
SYVALTDRLGNLTIVIETMSHNNSICIRPPLPDYNVSAQYATFYLQGSFKNLQELQVWYS
SLDINNTKPVTFKKLSPLKVQNGSFTLQLGVNEVYTITTLLTGQKGSFPDPPESKPFPLK
YKDDFSVRNPPFSEAPYFADQSGVFEYFTNTSDPGDHVFTFRQVLTQRPITWASDANQAI
SVIGNYQWSNVTVTSDIYIETPDTGGVFVAARVDQGGSPTDRAKGIFFWVFADGTYKVTG
DLMGQTILCKGLAGVRARSWHTLTLHIDGTNAFGLLNGNPLWKEVVTGGPLNGWAAIGTS
CFEFAQFDNFMIEVKDSE
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaggacggtgcttgctggttccaggagggctccgggctgtggtgaaggcatgtttatt
ctgtggctggtattgctgttgttcccaggagccccagcccagtattcagtagatgatctc
ggagggcttggtcgtatgttcgatgggatcggagcaatcagcggaggaggagcaacgtct
cggcttcttgtaaactacccagaaccacaaagaactgagatcctggattacttgttcaag
ccaaattttggtgcctctttgcacatcttcaaggttgaaattggaggtgacgcacaaaca
acagacggaactgaaccatctcatatgcactaccccgatgatcagaactacttccgaggt
tatgaatggtggttgatgaaagaggcaaagaagagaaaccctgcaataaaactcataggt
ttgccttgggcttttcctggctggattggtaatggcaaaaactggccttacgattttcct
gatgtgacggcttattatgttgtgtcatggattataggtgccaagcaatatcataacttg
gatatcgactacattgggatttggaatgagagagcctatgacataaaatacataaagctt
ttgcgctacacgttggataaaaacaatttggagcatgtgaagataatagccagcgataac
ctatggcaacccatcgcctttcatatgctacaggatcctgagctgctcagggtggtcgat
gttataggtgcccactatcctggaacccacgcagcacaggatgctattctgacagggaag
actctctgggcctctgaagattacagcacttacaatgatgaggtcggtggaggttgttgg
gctcggattctaaaccaaaactatgtgaatggaaacatgacttcgactatctcttggaat
atggtggccagttactatgaacagttaccttttggtttggaagggctgatgactgccaag
gagccatggagtggaaattatgtggtatcaacacccatatggatcactgcacacactacc
cagttcacgcagccaggctggtactatctcaaaacggttggacatttagacaaaggtgga
agctacgtggcactgactgaccggttgggaaacctgacgattgtcattgagaccatgtca
cacaacaactctatctgcatccgtcctccactgccagactataatgtttcagctcagtat
gctacgttctaccttcaaggctcctttaaaaacctgcaagaactgcaggtttggtattca
agtctggacatcaacaacaccaaacctgttacattcaaaaaactgtctccactaaaggta
caaaatggttctttcacattgcagctgggggtgaatgaagtttacacaataacaaccctg
ttgactggacagaagggttcatttcctgatccacctgaatccaaacctttccctctaaaa
tacaaggatgacttcagtgtcagaaacccccccttctcagaggccccttattttgcagat
cagtctggtgtatttgaatatttcacaaatacttctgacccaggcgatcatgtcttcacc
tttcgccaagttctcactcaacgtcctattacttgggcatcggatgctaaccaagccatt
agtgtgattggtaactaccaatggtctaatgttacagtgacaagtgacatttacattgaa
accccggacaccggaggggtgtttgttgctgctagagtggatcagggaggctcaccgact
gaccgggcaaagggtatatttttctgggtgtttgctgatggcacatataaagtcactggg
gatttaatgggccagactattctgtgcaaggggctggcaggtgttcgtgctagaagctgg
catacactgaccctacatattgatggtactaatgcatttgggctgctaaatggaaatccc
ttgtggaaagaagttgtgactggaggacctttgaatggctgggctgccattgggacaagc
tgctttgaatttgcacagtttgataactttatgattgaggtcaaagattctgagtga

DBGET integrated database retrieval system