KEGG   Xenopus tropicalis (western clawed frog): 779769
Entry
779769            CDS       T01011                                 

Gene name
gpc1
Definition
(RefSeq) glypican-1 precursor
  KO
K08107  glypican 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:xtr00535]
    779769 (gpc1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xtr00537]
    779769 (gpc1)
Proteoglycans [BR:xtr00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   779769 (gpc1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:xtr00537]
 Others
  779769 (gpc1)
SSDB
Motif
Pfam: Glypican IL32 TINF2_N PAXIP1_C
Other DBs
NCBI-GeneID: 779769
NCBI-ProteinID: NP_001072316
Xenbase: XB-GENE-964661
UniProt: Q0V9W0
Position
5
AA seq 554 aa
MERLCWGWWWHLGILCLMHWAAGDTGSKTKSCSEVKQVYLAKGFSLNGAPQSEISGEHLR
ICPQGYTCCTSEMEENFANISRVEFEAKLRESSASIQRLLTTQHRNFDSYFQDLLNTSER
VLQERFPSQYGDLYSQNSKIFRDLYSELRQYYRGSGINLEEALIEFWSRLLERVFKAQHT
QYSFSEEYMDCLVKQYEQLKPFGDTPREVKLKAARAFIAARSFVQGLNAAADVVRKANQV
PMSTECARAVMKLVYCPHCRGHSSIKLCSNYCWNVMRGCLANQADLDSEWRNLIESLLLV
ADKFNGASNVENIVGAIHTKISEAITHMQENKELLTNKVFKICGTPKKTNKGSKSEERRR
KGKATQEDKSAVATMDNLISDVKGILSDIQDYWVSLPSLFCTEKVTAGPGNEDKCWNGIT
KGRYMPEPMGSGLANQINNPEVDVDITKPDMTIRQQIMQLKIMTSRLRNAYNGNDVDFQD
TSDDMSGSGSGDGCNEDLCGSGRKLSRETVIIQPATHAVPRQPNPGETGKGTRLSSWDLL
ICLVALLVAQCTRW
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggagcggctctgctggggttggtggtggcatcttggcattttgtgccttatgcactgg
gcagctggagacactggaagtaaaaccaaaagctgcagtgaggtgaagcaggtgtacctg
gctaagggcttcagcctgaatggagcgccacaatcggaaatctcaggagagcatctgagg
atctgccctcaaggttacacctgctgcacctcagagatggaggagaactttgccaatatc
agcagagtggagtttgaggccaaactgagggaatccagcgcttctattcagaggctgctc
accacacagcacaggaactttgacagttacttccaggacttgctgaatacatcagagcgg
gttcttcaagaacgcttccctagccaatatggagatctttacagccaaaatagcaagata
ttcagagacttgtactcagaactgcgtcagtattacagaggctccggaattaacctggag
gaagccttgatcgaattctggagccgtctgctggagcgtgtgttcaaggcgcagcacaca
cagtactccttttcagaagagtatatggactgtttagtgaagcaatatgagcagctcaag
ccctttggggacacaccacgagaggtgaagctaaaagcagcccgagcgtttattgcagcc
cgttcctttgttcaggggctcaatgctgcagctgatgttgtcaggaaagccaaccaggtt
cccatgagcacagagtgtgcacgtgcagtcatgaagctcgtgtactgtcctcactgccgc
ggccattccagcataaagctatgtagcaactactgctggaacgttatgcgcggctgtctg
gccaaccaggcggatctggactcagaatggagaaaccttattgagtcactgctgctggtg
gcagacaagtttaatggggcttccaatgtggagaatattgtaggtgcaatccacaccaag
atctctgaggcaataacccacatgcaagaaaacaaagaactcctaacaaacaaggtgttt
aagatctgcggcactccaaaaaagaccaacaaaggttccaaatctgaagagagaagacgg
aaaggaaaggctactcaggaagataaatctgctgttgccacaatggacaacctgatttca
gatgtgaaaggaatactgagtgatattcaagattactgggtttctctaccaagtttattt
tgcacagaaaaggtgactgctggcccgggaaatgaggacaagtgctggaatggaataact
aagggcaggtatatgcctgaacccatgggtagtggtttggccaatcaaattaacaaccca
gaggtcgatgttgacattacaaagcccgatatgaccattcgacagcaaataatgcagctg
aagatcatgacaagtcgcctaaggaatgcatacaatggcaacgatgtggattttcaggac
actagcgatgacatgagcggctctggaagtggcgacggctgcaatgaggacctatgcggc
agtggtagaaagctctctagagaaactgtcataattcagccggccacgcacgcagttcca
aggcagcctaaccctggggagacagggaagggtacccgcctctcttcctgggacctactc
atatgtcttgtggctctacttgttgcacagtgcacccgatggtaa

DBGET integrated database retrieval system